KEGG   Desulfovibrio desulfuricans ND132: DND132_1469Help
Entry
DND132_1469       CDS       T01709                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ddn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DND132_1469
  Amino acid metabolism
   00330 Arginine and proline metabolism
    DND132_1469
Enzymes [BR:ddn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     DND132_1469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1627920..1629080
Genome map
AA seq 386 aa AA seqDB search
MTKSPITRDTLLDNVRRVVIKVGSAVLTTRDGLNGAAINRLADQLSELSNRGLDVVLVSS
GAVAAGRQRIYERTRKKHRNGKDMVSRQAASAVGQGRLMHDYDEAFARHGKVTAQVLLTR
SGLKLRDRFLNARNTLERLLEWGVIPIINENDTVSTRELEFGDNDTLAAMCLGLVGADLF
VNMTSADGVFDRNPDGDPEARPIPLIEDIAALDLEAMCDGKSSVGTGGMYSKLRAARRAA
QLGVPTLIVTGKGAFDIPAVLAGDQGGTLVLPDERVVSSKKFWLAYHDDPSGAVLVDGGA
ANALLTKGTSLLPIGITGVEGCFERGALIFIKTADGVELGVGQTNYSADELCRIKGKRTD
ELAAIIGPTVSDEAVHRDNMLLDAAI
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaatcgcccattacccgagacaccctgctggacaacgtccggcgggtggtgatc
aaggtaggctcggccgtgctgaccacccgcgacggcctgaacggcgcggccatcaaccgg
ctggcggaccagctgtcggaactgtcgaaccgggggctggacgtggtcctggtctcctcg
ggcgcggtggccgcgggcagacagcgcatctacgagcggacccggaagaagcaccgcaac
ggcaaggacatggtctcccggcaggcggcctcggccgtgggccagggacggctcatgcac
gactacgacgaggcctttgcccggcacggcaaggtcacggcccaggtcctgctgacccgc
agcgggctgaagctgcgcgaccgcttcctgaacgcgcgcaacaccttggaacggctcctg
gaatggggcgtcatcccgatcatcaacgagaacgacaccgtgtccacccgcgaactggag
ttcggggacaacgacaccctggccgccatgtgcctggggctggtcggcgcggatctgttc
gtgaacatgacctcggccgacggggtcttcgaccggaacccggacggcgatccggaggcc
aggcccatcccgctcattgaggacatcgcggccctggacctcgaggccatgtgcgacggc
aagagcagcgtgggcacaggcggcatgtactccaagctgcgcgcggcccggcgggcggcc
cagctgggcgtgcccaccctgatcgtcacgggcaagggcgccttcgacatcccggccgtg
ctcgccggagaccagggcggcaccctggtcctgcccgacgagcgcgtggtctcgagcaaa
aaattctggctggcctaccacgacgacccgtccggggccgtcctggtggacggcggcgcg
gccaacgccctgctgaccaagggcacgtcgctgctgcccatcggcatcaccggggtggag
ggctgcttcgaacgcggggcgctgatcttcatcaagacggcggacggcgtggaactcggc
gtgggccagaccaactattccgccgacgaactctgccgcatcaagggcaagcgcacggac
gaactggcggccatcatcgggcccacggtctcggacgaggccgtacaccgcgacaacatg
ctcctggacgcggccatctga

DBGET integrated database retrieval system