KEGG   Desulfovibrio desulfuricans ND132: DND132_2048Help
Entry
DND132_2048       CDS       T01709                                 

Definition
uroporphyrin-III C-methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DND132_2048
Enzymes [BR:ddn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     DND132_2048
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     DND132_2048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2276906..2278420)
Genome map
AA seq 504 aa AA seqDB search
MANVFLVGAGPGDPGMLTLRAREIIESCDVMIYDYLANAEFLKWCKPDCEILYVGKKGGD
HTLPQDKINDLIVDKARSGKIVCRLKGGDPYVFGRGGEEGEELVEAGMDFEVVPGITAGV
AAAAYAGIPVTHRDFTTSVCFITGHEDPTKSDSGHNWAVYGQSTSTLVFYMGVGNLPMIA
KNLMDNGRAADTPVALVRWGTRCNQTSFVSDLEHVAEEAKARNWQAPSIIIVGGVCSLHD
KLGWFEKKPLLGKGVIVTRAREQASGLVGVLREQGACVREFPTISVEPLDDYAEVETAIL
QLARYQWVVFTSVNGVRFFWRQLRAIGLDARIFGGMQIAAIGPATADELRTRGIEPDFIP
DKYVAEHVVKGLLERGIQGSDVLIPRAKVAREVLPRELKAAGCNVTVLPVYETRLGQASG
DEIMETLGAGDIRYVTFTSSSTVENFFELVPADAFKNYPDVKIASIGPVTSDTVRKFGLT
PAIEPEDYTIPGLVDALLKDAGAK
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgtattcctcgtcggcgctgggcccggtgatccgggcatgttgaccctgcgg
gccagggagatcatcgagtcctgcgacgtgatgatctacgactacctggccaatgccgag
ttcctgaagtggtgcaagcccgactgcgagattctctacgtgggcaagaagggcggcgac
cacaccctgccccaggacaagatcaacgacctcatcgtggacaaggcccggtccggcaag
atcgtctgccgcctcaagggcggggacccctacgtcttcgggcgcggcggcgaagagggc
gaggagctggtcgaggcgggcatggacttcgaggtggtgcccggcatcaccgcgggcgtg
gcggccgcggcctacgcgggcatcccggtgacccaccgcgacttcaccacctcggtctgt
ttcatcaccggccacgaggacccgaccaaatccgattccggccacaactgggccgtgtac
gggcagtccacctccacgctggtcttctacatgggcgtgggcaacctgcccatgatcgcg
aaaaatctcatggacaacggccgcgccgccgacaccccggtggccctggtccgctggggc
acgcgctgcaaccagacctcgttcgtgtccgacctcgagcacgtggccgaggaggccaag
gcgcgcaactggcaggccccgtccatcatcatcgtgggcggcgtctgctccctgcacgac
aagctcggctggttcgagaagaagcccctgctcggcaagggcgtcatcgtcacccgcgcc
cgcgagcaggcctcgggcctggtcggcgtcctgcgcgaacagggcgcgtgcgtgcgcgag
ttcccgaccatctcggtggagccgctggacgactacgccgaggtcgagaccgccatcctg
caactggcccgctaccagtgggtcgtgttcacctcggtcaacggggtcagattcttctgg
cggcagctccgggccatcggcctggacgcgcgcatcttcggcggcatgcagatcgcggcc
atcggcccggccacggcggacgagctgcgcacgcgcggcatcgagccggacttcatcccg
gacaagtacgtggccgaacacgtggtcaaggggctgctcgaacgcggcatccagggctcg
gacgtgctcatcccccgggccaaggtggcgagagaggtcctgccccgcgagctcaaggcg
gcgggctgcaacgtcacggtcctgccggtctacgagacccgcctgggccaggcgtccggc
gacgagatcatggagacgctgggcgcgggcgacatccgctacgtgaccttcacctcgtcg
agcacggtggagaacttcttcgagctggtcccggccgacgccttcaagaactacccggac
gtgaagatcgcctccatcggcccggtcacctccgacacggtccggaaattcggcctgacc
ccggccatcgagcccgaggactacaccatccccggcctggtggacgcgctgctcaaggac
gcgggcgccaagtag

DBGET integrated database retrieval system