KEGG   Desulfovibrio desulfuricans ND132: DND132_2266Help
Entry
DND132_2266       CDS       T01709                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ddn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DND132_2266
   01230 Biosynthesis of amino acids
    DND132_2266
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DND132_2266
   00030 Pentose phosphate pathway
    DND132_2266
   00051 Fructose and mannose metabolism
    DND132_2266
   00052 Galactose metabolism
    DND132_2266
  Energy metabolism
   00680 Methane metabolism
    DND132_2266
Enzymes [BR:ddn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     DND132_2266
Protein phosphatases and associated proteins [BR:ddn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     DND132_2266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2513277..2514572)
Genome map
AA seq 431 aa AA seqDB search
MKRLDFVTEIPNLGKAKIKSPLKNARFVDESIPVTLMLTSGELTELDTDVLQKDFEKAGP
REQVYFDTSKARCAVVTCGGICPGINDVIRAIVHEAHYHYGVRHVLGITNGLRGFIPKYG
YDIKELTPETVSHIHQFGGTILGSSRGLQDPVEIVDSLERLNINILFVIGGDGAMRAARS
IVNEISERKRNIAVIGIPKTIDNDINFITRSFGFDTAVEKAAEVIQCAHVEATGIDMGVG
LVKLMGREAGFIAAQATLAMQEVNFLLVPEQPFTLAGPGGLLEAVETRLKERKHSIIVCA
EGAGQDLLGGELERDPSGNPKLGDICGLIVSELEKYALSKDFEINIKFIDPSYLIRSVPA
NAGDRVYCGFLGQNAVHAAMAGKTAMVVSRLKSSMVHLPLDLVATERRRININSDWWASV
MEATGQREYLK
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcctggatttcgttacggaaataccgaatctcggcaaggccaagatcaaatcg
ccgctgaagaacgcccggttcgtggacgagtcgattccggtgacgctgatgcttacctcg
ggcgagctgaccgagttggacaccgacgtactgcaaaaggatttcgaaaaggccggaccg
cgcgagcaggtctatttcgacacctccaaggcgcgctgcgccgtcgtcacctgcggcggc
atctgcccgggcatcaacgacgtcatccgggccatcgtgcacgaggcccactaccactac
ggcgtgcgccacgtgctcggcatcaccaacgggctgcgcggcttcattcccaagtacggc
tacgacatcaaggaactcaccccggagaccgtctcacacatccaccagttcggcgggacc
atcctgggttcgtcgcgcgggcttcaggacccggtggagatcgtcgattcactggagcgg
ctgaacatcaacatcctgttcgtcatcggcggcgacggcgccatgcgcgcggccaggtcc
atcgtcaacgagatatccgagcgcaagcggaacatcgccgtcatcggcatccccaagacc
atcgacaacgacatcaacttcatcacccgctcctttggtttcgacacggccgtggaaaag
gccgccgaggtcatccagtgcgcccacgtggaggccaccggcatcgacatgggcgtgggt
ctggtcaagctcatgggccgggaagcgggcttcatcgcggcccaggccaccctggccatg
caggaggtcaacttcctcctggtcccggaacagcccttcaccctggccggaccgggcggc
ttgctcgaggccgtggagacccggctcaaggaacgcaagcattccatcatcgtctgcgcc
gagggcgcgggccaggatctgctcggcggggaactcgaacgagacccctcgggcaacccc
aaactgggcgacatctgcggcctcatcgtctccgaactcgagaaatacgccctgtccaag
gattttgagatcaacataaaattcattgatcccagctacctgattcgatccgtcccggcc
aatgcgggcgatcgggtctactgcggattcctcgggcagaacgccgtgcacgcggccatg
gccggcaagaccgccatggtcgtctcccggctcaaatcgagcatggtccacctgcccctg
gacctggtggccaccgaacgccgccgcatcaacatcaactccgactggtgggcctccgtc
atggaagccaccgggcaacgcgagtatctcaagtag

DBGET integrated database retrieval system