KEGG   Desulfovibrio desulfuricans ND132: DND132_2354Help
Entry
DND132_2354       CDS       T01709                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ddn00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2602687..2604039)
Genome map
AA seq 450 aa AA seqDB search
MTFIPQEIIRRKRDGLALDRADIRAMVRGITDGSASEGQVAAFAMAVFFRGMTLRERIDL
TEAMRDSGRVLDWPGMGLERGVVDKHSTGGVGDKVSLILGPLAAACGAFVPMISGRGLGH
TGGTLDKFDAIPGYDTAPDLETFARVVREAGCAIIGQTTDLAPADRRLYAVRDVTATVES
VDLITASILSKKLAAGLQGLVMDVKFGSGAFMEDFADACALAESIVTVATGAGVPTTALL
TDMNEVLGDCVGNAVEVREAVDFLTGVRREPRLAEVTLALTGEMLVLAGVVADPDAAARR
MEQALASGAAAERFGRMVAGLGGPRDILERTDVYLPKPPVARPVYPNRTGFVAAMDSRAV
GMTLVAMGGGRTRADQAIDHGVGMTGFARIGDPVAPDIPLCVVHARDTAQADMAAERIRR
AVTISDAPPAPRPVVRRRITAREEPAQETN
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgacgttcataccgcaggagatcattcgcaggaagcgggacggcttggcgctcgaccgg
gccgacatccgggccatggtccggggcatcacggacggttcggccagcgagggccaggtg
gcggcgttcgccatggcggtcttttttcgcggcatgaccctgcgcgagcgcatcgacctg
accgaggccatgcgcgactcgggccgggtcctggactggccgggcatgggccttgagcgc
ggcgtggtggacaagcattcgaccggcggcgtgggcgacaaggtcagcctgattctcggc
cccctggcggcggcctgcggcgcgttcgtgcccatgatctccggacgcggcctggggcac
acgggcggcaccctggacaagttcgacgccattccgggctacgacaccgccccggacctg
gagaccttcgcgcgcgtggtccgcgaggcgggctgcgccatcatcggccagacaacggac
ctggccccggccgaccggcggctgtacgccgtgcgcgacgtgaccgccacggtggagtcc
gtggacctgatcaccgcctccatcctgtccaagaagctggctgccgggctccaggggctg
gtcatggacgtgaaattcggctccggcgcgttcatggaagatttcgcggacgcctgcgcc
ctggccgagtccatcgtcaccgtggccacgggcgctggcgtgcccaccacggccctgctc
acggacatgaacgaggtcctgggcgactgtgtgggcaacgccgtggaggtccgcgaggcc
gtggacttcctgaccggcgtccggcgcgaaccccgcctggccgaggtcaccctggccctg
accggcgagatgctcgtcctggcgggagtcgttgcggacccggacgcggccgcgcgcagg
atggaacaggccctggccagcggcgcggccgccgagcggttcggccgcatggtcgccggg
ctgggcgggccaagggatatcctggagcggacggacgtttacttgccgaaaccgcccgtg
gcgcggcccgtgtacccgaaccggaccggcttcgtcgcggccatggacagccgcgccgtg
ggcatgaccctggtggccatgggcggcggccgcacccgcgcggaccaggccatcgaccac
ggcgtgggcatgaccggcttcgcccgcatcggcgatcccgttgccccggacatccccctg
tgcgtggtccacgcccgcgacacggcacaggccgacatggccgcagaacgcattcgccgg
gccgtgaccatcagcgacgcgccaccggccccgcgcccggtcgtccgccgccggatcacc
gcccgcgaggaacccgcacaggagaccaactga

DBGET integrated database retrieval system