KEGG   Desulfovibrio desulfuricans ND132: DND132_2447Help
Entry
DND132_2447       CDS       T01709                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ddn00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ddn00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2715959..2716888
Genome map
AA seq 309 aa AA seqDB search
MKWLHKDLLDVSQLSQPEVMAIFETAGRFQELQERPVKKVPTLKGRSVVLFFAEPSTRTK
TSFDVAGKRLSADTFSLAKSSSSLTKGESLKDTALTLQAMAPDAIVIRHWCSGAARFLAD
RLDCSVINAGDGRHAHPTQALLDSFTLYQEWGGVAGKTILILGDIAHSRVARSNVILLTM
LGAKVRLCGPRTLLPPALKTWPVTVFSDLNEAVKGVDAVMCLRLQLERQKDGLLPDLREY
SRTFGMGMKQVELANPDVRILHPGPLNRGVEINSELADSAGSLILDQVASGVVVRMALLF
LYMTRKGEE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggttacacaaggacctgctggacgtgtcccagctctcccagccggaggtcatg
gcgatcttcgagacggcggggcggttccaggagttgcaggaacggccggtcaagaaggtg
ccgaccctgaaagggcgcagcgtggtgctcttcttcgccgagccgagcacgcgcaccaag
accagcttcgacgtggccgggaaacggctgtccgccgacaccttctccctggccaagagt
tcaagcagcctgaccaagggcgaatccctcaaggacaccgccctgaccctccaggccatg
gccccggacgccatcgtcatccggcactggtgctcgggcgcggcccggttcctggccgac
cggctggactgctcggtcatcaacgcgggcgacgggcggcacgcgcaccccacccaggcg
ttgctcgactccttcaccctgtaccaggagtggggcggcgtggccggcaagaccatcctc
atcctcggggacatcgcccacagccgcgtggcccggtccaacgtcatcctgctgaccatg
ctcggggccaaggtccggctgtgcgggccgcgcaccctgctgcccccggccctcaagacc
tggccggtcacggtcttctccgacctgaacgaggcggtcaaaggcgtggacgcggtcatg
tgcctgcgcctccagctggaacgccagaaggacgggctgctgcccgacctgcgcgaatac
tcccggaccttcggcatgggcatgaaacaggtggagctggccaacccggacgtgcgcatc
ctccaccccggcccgctcaaccggggcgtggagatcaactccgaactggccgactcggct
ggctccctcatcctcgaccaggtcgccagcggcgtggtcgtgcgcatggccctgctgttc
ctgtacatgaccaggaagggagaggagtag

DBGET integrated database retrieval system