KEGG   Desulfovibrio desulfuricans ND132: DND132_2447Help
Entry
DND132_2447       CDS       T01709                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddn00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    DND132_2447
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DND132_2447
Enzymes [BR:ddn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     DND132_2447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2715959..2716888
Genome map
AA seq 309 aa AA seqDB search
MKWLHKDLLDVSQLSQPEVMAIFETAGRFQELQERPVKKVPTLKGRSVVLFFAEPSTRTK
TSFDVAGKRLSADTFSLAKSSSSLTKGESLKDTALTLQAMAPDAIVIRHWCSGAARFLAD
RLDCSVINAGDGRHAHPTQALLDSFTLYQEWGGVAGKTILILGDIAHSRVARSNVILLTM
LGAKVRLCGPRTLLPPALKTWPVTVFSDLNEAVKGVDAVMCLRLQLERQKDGLLPDLREY
SRTFGMGMKQVELANPDVRILHPGPLNRGVEINSELADSAGSLILDQVASGVVVRMALLF
LYMTRKGEE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggttacacaaggacctgctggacgtgtcccagctctcccagccggaggtcatg
gcgatcttcgagacggcggggcggttccaggagttgcaggaacggccggtcaagaaggtg
ccgaccctgaaagggcgcagcgtggtgctcttcttcgccgagccgagcacgcgcaccaag
accagcttcgacgtggccgggaaacggctgtccgccgacaccttctccctggccaagagt
tcaagcagcctgaccaagggcgaatccctcaaggacaccgccctgaccctccaggccatg
gccccggacgccatcgtcatccggcactggtgctcgggcgcggcccggttcctggccgac
cggctggactgctcggtcatcaacgcgggcgacgggcggcacgcgcaccccacccaggcg
ttgctcgactccttcaccctgtaccaggagtggggcggcgtggccggcaagaccatcctc
atcctcggggacatcgcccacagccgcgtggcccggtccaacgtcatcctgctgaccatg
ctcggggccaaggtccggctgtgcgggccgcgcaccctgctgcccccggccctcaagacc
tggccggtcacggtcttctccgacctgaacgaggcggtcaaaggcgtggacgcggtcatg
tgcctgcgcctccagctggaacgccagaaggacgggctgctgcccgacctgcgcgaatac
tcccggaccttcggcatgggcatgaaacaggtggagctggccaacccggacgtgcgcatc
ctccaccccggcccgctcaaccggggcgtggagatcaactccgaactggccgactcggct
ggctccctcatcctcgaccaggtcgccagcggcgtggtcgtgcgcatggccctgctgttc
ctgtacatgaccaggaagggagaggagtag

DBGET integrated database retrieval system