KEGG   Desulfovibrio desulfuricans ND132: DND132_2716Help
Entry
DND132_2716       CDS       T01709                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
ddn00010  Glycolysis / Gluconeogenesis
ddn00620  Pyruvate metabolism
ddn00640  Propanoate metabolism
ddn00680  Methane metabolism
ddn01100  Metabolic pathways
ddn01110  Biosynthesis of secondary metabolites
ddn01120  Microbial metabolism in diverse environments
ddn01130  Biosynthesis of antibiotics
ddn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ddn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DND132_2716
   00620 Pyruvate metabolism
    DND132_2716
   00640 Propanoate metabolism
    DND132_2716
  Energy metabolism
   00680 Methane metabolism
    DND132_2716
Enzymes [BR:ddn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     DND132_2716
Lipid biosynthesis proteins [BR:ddn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   DND132_2716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: EGB15919
UniProt: F0JJ20
Position
3021435..3023072
Genome map
AA seq 545 aa AA seqDB search
MFTKEEYVDYKDFCERYTPQCPEDFNFAFDVLDAKDPKTPALIHVDDHYNRRDFDFGYFQ
ETSSRLANALVAKGVKKGDRVMVILYRRVEYWVTMLALHRIGAVPIPSPSLLTRKDIRER
VNYAGISTLICEDSIVERVDRARPDCPGLKLLVQVEGKAENGWLDFDALLASGDPSFPRT
PDSPGGNDPMVIFFSSGTTGLPKMVLHNHKYAASHYTTGALWHDLEPGDIHLTVSDTGWG
KSVWGKFYGQWMAGAIIFVWDFRGKFHPGDLLRVVADNKVTTFCAPPTIYRFLVREDLSQ
YDLSNLRHCTTAGELLNDSVFHAWQKAVGMPIFEGYGQTETTLQVATFKFMEPKPGSIGK
PVPGWNIALMDEEGKPVPQGEEGEICINIDSPVLGLFDSYMDEPEKTACVKCHGWYHTGD
KAWADEDGYLWFMGRTDDLIKSSGYRIGPFEVESALVAHDAVIEAAVTGLPDDVRGQLVK
ATVVLAPGYEPSEDLTKQLQSFVRELTAPYKYPRVIEYVDELPKTISGKIKRKEIREADL
ARLAK
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgttcaccaaagaagaatacgtcgattacaaggatttttgcgaacgatacacgccccag
tgccccgaggatttcaacttcgccttcgacgtcctggacgccaaggacccgaaaaccccg
gcgctcatccacgtggacgaccactacaaccggcgcgatttcgatttcggctatttccag
gagacctcctcccggctggccaacgcgctggtcgccaagggtgtgaaaaagggcgaccgg
gtcatggtcattctctaccggcgggtggaatactgggtgaccatgctcgccctgcaccgc
atcggcgcggtgcccatcccgtccccgtccctgctgacccgcaaggacatccgcgagcgc
gtcaactacgcgggcatctccaccctcatctgcgaggactccatcgtggagcgcgtggac
cgggcccggcccgactgccccggtctgaaactgctcgtccaggtggagggcaaggccgaa
aacggctggctcgactttgatgcgctgctcgcctcgggcgatccgagcttcccgcgcacc
ccggactcccccggcggcaacgaccccatggtcatcttcttctcctccggcaccacgggc
ctgcccaagatggtcctgcacaaccacaagtacgccgcgtcccactacaccaccggcgcg
ctgtggcacgacctggagccgggcgacatccacctgaccgtgtccgacacgggctggggc
aagtcggtctggggcaagttctacggccagtggatggccggggcgatcatcttcgtctgg
gatttccggggcaagttccatcccggcgacctgctcagggtcgtggccgacaacaaggtg
accaccttctgcgcgccgccgaccatctaccgcttcctggtgcgcgaggacctgtcccag
tacgacctgtccaacctgcgccactgcaccacggcgggcgagctgctcaacgactcggtc
ttccacgcctggcaaaaggccgtgggcatgcccatcttcgagggctacggccagaccgag
accaccctgcaggtggccaccttcaagttcatggagcccaagcccggctccatcggcaag
cccgtgcccggctggaacatcgccctcatggacgaggagggcaaacccgtgccccagggc
gaggagggcgagatctgcatcaacatcgactcgcccgtgctcggcctgttcgactcctac
atggacgagccggaaaagaccgcctgcgtcaagtgccacggctggtaccacaccggggac
aaggcctgggccgacgaggacggctacctctggttcatgggccgcaccgacgacctgatt
aaatcctcggggtaccgcatcggacccttcgaggtggagtccgccctggtggcccacgac
gcggtcatcgaggccgccgtcaccggcctgcccgacgacgtgcgcggccagctggtcaag
gccaccgtggtcctggcccccggctacgagccgtccgaagacctgaccaagcagctccag
tcctttgtccgcgaactgaccgcgccgtacaaatacccgcgcgtcatcgaatacgtggac
gaactgcccaagaccatctccggcaagatcaaacgcaaggaaatccgcgaagccgacctc
gcccgcctggcgaagtag

DBGET integrated database retrieval system