KEGG   Desulfovibrio desulfuricans ND132: DND132_2716Help
Entry
DND132_2716       CDS       T01709                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ddn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DND132_2716
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DND132_2716
   00620 Pyruvate metabolism
    DND132_2716
   00640 Propanoate metabolism
    DND132_2716
  Energy metabolism
   00680 Methane metabolism
    DND132_2716
Enzymes [BR:ddn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     DND132_2716
Lipid biosynthesis proteins [BR:ddn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   DND132_2716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3021435..3023072
Genome map
AA seq 545 aa AA seqDB search
MFTKEEYVDYKDFCERYTPQCPEDFNFAFDVLDAKDPKTPALIHVDDHYNRRDFDFGYFQ
ETSSRLANALVAKGVKKGDRVMVILYRRVEYWVTMLALHRIGAVPIPSPSLLTRKDIRER
VNYAGISTLICEDSIVERVDRARPDCPGLKLLVQVEGKAENGWLDFDALLASGDPSFPRT
PDSPGGNDPMVIFFSSGTTGLPKMVLHNHKYAASHYTTGALWHDLEPGDIHLTVSDTGWG
KSVWGKFYGQWMAGAIIFVWDFRGKFHPGDLLRVVADNKVTTFCAPPTIYRFLVREDLSQ
YDLSNLRHCTTAGELLNDSVFHAWQKAVGMPIFEGYGQTETTLQVATFKFMEPKPGSIGK
PVPGWNIALMDEEGKPVPQGEEGEICINIDSPVLGLFDSYMDEPEKTACVKCHGWYHTGD
KAWADEDGYLWFMGRTDDLIKSSGYRIGPFEVESALVAHDAVIEAAVTGLPDDVRGQLVK
ATVVLAPGYEPSEDLTKQLQSFVRELTAPYKYPRVIEYVDELPKTISGKIKRKEIREADL
ARLAK
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgttcaccaaagaagaatacgtcgattacaaggatttttgcgaacgatacacgccccag
tgccccgaggatttcaacttcgccttcgacgtcctggacgccaaggacccgaaaaccccg
gcgctcatccacgtggacgaccactacaaccggcgcgatttcgatttcggctatttccag
gagacctcctcccggctggccaacgcgctggtcgccaagggtgtgaaaaagggcgaccgg
gtcatggtcattctctaccggcgggtggaatactgggtgaccatgctcgccctgcaccgc
atcggcgcggtgcccatcccgtccccgtccctgctgacccgcaaggacatccgcgagcgc
gtcaactacgcgggcatctccaccctcatctgcgaggactccatcgtggagcgcgtggac
cgggcccggcccgactgccccggtctgaaactgctcgtccaggtggagggcaaggccgaa
aacggctggctcgactttgatgcgctgctcgcctcgggcgatccgagcttcccgcgcacc
ccggactcccccggcggcaacgaccccatggtcatcttcttctcctccggcaccacgggc
ctgcccaagatggtcctgcacaaccacaagtacgccgcgtcccactacaccaccggcgcg
ctgtggcacgacctggagccgggcgacatccacctgaccgtgtccgacacgggctggggc
aagtcggtctggggcaagttctacggccagtggatggccggggcgatcatcttcgtctgg
gatttccggggcaagttccatcccggcgacctgctcagggtcgtggccgacaacaaggtg
accaccttctgcgcgccgccgaccatctaccgcttcctggtgcgcgaggacctgtcccag
tacgacctgtccaacctgcgccactgcaccacggcgggcgagctgctcaacgactcggtc
ttccacgcctggcaaaaggccgtgggcatgcccatcttcgagggctacggccagaccgag
accaccctgcaggtggccaccttcaagttcatggagcccaagcccggctccatcggcaag
cccgtgcccggctggaacatcgccctcatggacgaggagggcaaacccgtgccccagggc
gaggagggcgagatctgcatcaacatcgactcgcccgtgctcggcctgttcgactcctac
atggacgagccggaaaagaccgcctgcgtcaagtgccacggctggtaccacaccggggac
aaggcctgggccgacgaggacggctacctctggttcatgggccgcaccgacgacctgatt
aaatcctcggggtaccgcatcggacccttcgaggtggagtccgccctggtggcccacgac
gcggtcatcgaggccgccgtcaccggcctgcccgacgacgtgcgcggccagctggtcaag
gccaccgtggtcctggcccccggctacgagccgtccgaagacctgaccaagcagctccag
tcctttgtccgcgaactgaccgcgccgtacaaatacccgcgcgtcatcgaatacgtggac
gaactgcccaagaccatctccggcaagatcaaacgcaaggaaatccgcgaagccgacctc
gcccgcctggcgaagtag

DBGET integrated database retrieval system