KEGG   Desulfovibrio desulfuricans ND132: DND132_3103Help
Entry
DND132_3103       CDS       T01709                                 

Definition
catalytic domain-containing protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ddn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DND132_3103
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DND132_3103
   00020 Citrate cycle (TCA cycle)
    DND132_3103
   00620 Pyruvate metabolism
    DND132_3103
Enzymes [BR:ddn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     DND132_3103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3468051..3469388
Genome map
AA seq 445 aa AA seqDB search
MAHDVIMPKWGLTMKEGKVARWLKGEGDPVEAGEPLFEVETDKITNSVEAPASGVLAKII
VPEGDVAPIQAVLAIIAAPGEAVDASAPAGAAKPAAEAAPAAAADKPAAAAPAGDGKFVP
AMPAARKLAKELGVDLSTVTGTGKDGKITAKDVQDAADSAYAGINASPKTIDFARKQGVD
LSQVTGTGEDGKITKADILRAMNPSAAQPAAGPAPAKDTIVPMEGVRKLVADNMQASLQN
AAQLTVFVELDVTEMVGLRAKLLERNKRNADYRVSYNDIIAYAVCRALKRHPVMNSTLQA
DGIHLHPHVNLGIAVSIDKGLIVPNVKEADTFGLEELKDKVRDAAGRARKGGLNMDEITG
GTFTISNVSMLGVDGFTPILNPPETGILGVGRIVEKPAVHNGEIVARQMMTLSLTFNHMT
TDGAPAMAFLRELGDMLEMPGLMIV
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggctcatgatgtgattatgcccaagtggggcctgaccatgaaagaaggtaaggtcgca
cgctggctcaagggcgaaggggacccggtcgaagccggggagcctctgttcgaagtcgag
accgacaagatcaccaactcggtcgaggcgcccgccagcggcgtcctggccaaaatcatc
gtccccgagggggacgtggccccgatccaggccgttttggccatcatcgccgccccgggc
gaagccgtcgatgcgtcggctcccgccggtgcggccaaacccgcggccgaagcggccccc
gccgccgctgccgacaagcccgccgccgctgccccggccggggacggcaagttcgttccg
gccatgcccgcagcgcgcaagctggccaaggaactgggcgtggacctgtccacggtgacc
ggtaccggcaaggacggcaagatcaccgccaaggacgtccaggacgccgctgattccgcc
tacgccgggatcaacgccagccccaagaccattgacttcgcccgcaagcagggcgtggac
ctcagccaggtgaccggcaccggcgaggacggcaagatcaccaaggcggacatcctgcgg
gccatgaacccgtcggccgcccagcccgccgccgggcctgcgcccgccaaggacaccatc
gtgcccatggaaggcgtgcgcaagctcgtcgcggacaacatgcaggccagcctgcagaac
gcggcccagctgaccgtgttcgtcgagctcgacgtcaccgagatggtcggcctgcgcgcc
aagctgctcgagcgcaacaagcgcaacgcggactaccgtgtgtcgtacaacgacatcatc
gcctacgccgtgtgccgcgcactgaagcgtcacccggtcatgaactccaccctccaggcg
gacggcatccatctgcatccgcacgtcaatctcggcatcgccgtgtccatcgacaagggg
ctcatcgtgcccaacgtcaaggaagcggacaccttcggcctggaagaactcaaggacaag
gttcgcgacgcggccggtcgggctcgcaagggcggcctgaacatggacgagatcacgggc
ggcaccttcaccatcagcaacgtgagcatgctcggcgtggacggtttcacgcccatcctc
aatccgccggagaccggcatcctgggcgtcggccgcatcgtcgagaagcccgcggtgcac
aacggcgagatcgtcgcgcgccagatgatgaccctgtccctgaccttcaaccatatgacc
acggatggggctccggccatggccttcctgcgcgagctgggagacatgctggaaatgccc
ggcctgatgatcgtctag

DBGET integrated database retrieval system