KEGG   Desulfovibrio desulfuricans ND132: DND132_3192Help
Entry
DND132_3192       CDS       T01709                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
ddn00260  Glycine, serine and threonine metabolism
ddn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ddn01100  Metabolic pathways
ddn01110  Biosynthesis of secondary metabolites
ddn01130  Biosynthesis of antibiotics
ddn01230  Biosynthesis of amino acids
Module
ddn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ddn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DND132_3192
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DND132_3192
Enzymes [BR:ddn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DND132_3192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: EGB16395
UniProt: F0JKE6
Position
complement(3580550..3581311)
Genome map
AA seq 253 aa AA seqDB search
MNPMQIHIEEARKKGKVGLIPFLPAGFPNRERFWKELAELDAAGASVIEIGMPFSDPVAD
GPVVEKASLKCLEDGINLTWILTELKKRKGQFKAALLLMGYLNPVYQYGLDKFGADCEAA
GVSGLIIADMPHEESQFVKDAVEPHGVALVPLVGLNTTKERMKLYADGAQGFCYFVSVLG
TTGQRDALPARIKEKLKEAKEVFDIPVALGFGIKHPDQLKEFEGLMDAAVFGSALISHIE
SGRSSDSFMEPWK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaatcccatgcagatacatattgaagaggcccgcaagaaaggcaaggtcggcctcatc
cccttcctgcccgcgggcttcccgaaccgtgagcggttctggaaggagctggcggaactc
gacgcggccggggcctcggtcatcgagatcggcatgcccttctccgaccccgtggccgac
ggcccggtggtggaaaaggcgtcccttaagtgcctcgaagacggcatcaacctgacctgg
atcctcacggagctcaagaagcgcaagggccagttcaaggcggccctgctgctcatgggc
tacctcaacccggtctaccagtacgggctcgacaagttcggcgcggactgcgaggccgcg
ggcgtgtccggcctgatcatcgcggacatgccccacgaggagtcccagttcgtcaaggac
gcggtcgagccgcacggcgtggctctggtccccctggtcggcctgaacaccaccaaggaa
cgcatgaagctctacgccgacggtgcgcaggggttctgctacttcgtgtctgtgctcggc
accacgggccagcgcgacgccctgcccgcgcgcatcaaggagaagctcaaggaggccaag
gaggtcttcgacatccccgtggccctgggcttcggcatcaaacatcccgaccagctcaag
gaattcgagggcctcatggacgccgccgtattcggctccgccctcatctcccacatcgaa
tccggccgctccagcgactccttcatggagccctggaagtag

DBGET integrated database retrieval system