KEGG   Desulfovibrio desulfuricans ND132: DND132_3195Help
Entry
DND132_3195       CDS       T01709                                 

Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ddn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DND132_3195
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DND132_3195
Enzymes [BR:ddn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     DND132_3195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3583122..3583892)
Genome map
AA seq 256 aa AA seqDB search
MLNKFREAKQLEIESLRKDFMEGRIPAMYQGERPSFTEAIRSKGPGAIIAEFKPASPSKG
VLRTDLDPMEVAETYAKNGAAAISVLTEHKYFKGTPDFLFMMNGPGLPLLRKDFIFDPLQ
VAMTASSPASAVLLIARMCDDAAHLKQLIDIARMPGLAPVVEIFDQADLDRAREAGADII
QVNNRDLDTLTTTLDQGRRFIKQKRDGELWICASGVSTRAQVEEMASLGFDAVLIGTSLM
EADDPGAKLAELAGVK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgctgaataagttccgcgaggccaagcagctcgagatcgagtcgctgcgcaaggacttc
atggaggggcgcatccccgccatgtaccagggtgaacgcccctccttcaccgaggccatc
cggtccaaggggccgggggcgatcatcgccgagttcaagccggccagcccgagcaagggc
gtgctgcgcacggatctcgaccccatggaggtggccgagacctacgccaagaacggcgcc
gccgccatctccgtgctgaccgagcacaagtacttcaagggcaccccggacttcctgttc
atgatgaacgggccggggctgcccctgctgcgcaaggacttcatcttcgacccgctccag
gtggccatgaccgcgtccagcccggcctcggccgtgctgctcatcgcccgcatgtgcgac
gacgccgcccacctgaagcagctcatcgacatcgcccgcatgcccggcctggccccggtg
gtcgagatattcgaccaggcggacctggaccgggcccgcgaggccggggcggacatcatc
caggtcaacaaccgcgacctggacaccctgaccaccaccctggaccagggccgacgcttc
atcaaacagaagcgcgacggcgagctgtggatctgcgccagcggcgtgtccacccgcgcc
caggtggaggagatggcctccttgggcttcgacgccgtgctcatcggcacctccctcatg
gaggccgacgatcccggcgccaagctggccgaactggcgggagtgaagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system