KEGG   Desulfovibrio desulfuricans ND132: DND132_3251Help
Entry
DND132_3251       CDS       T01709                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
ddn00260  Glycine, serine and threonine metabolism
ddn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ddn01100  Metabolic pathways
ddn01110  Biosynthesis of secondary metabolites
ddn01130  Biosynthesis of antibiotics
ddn01230  Biosynthesis of amino acids
Module
ddn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ddn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DND132_3251
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DND132_3251
Enzymes [BR:ddn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DND132_3251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP NAD_Gly3P_dh_N Peptidase_C14
Motif
Other DBs
NCBI-ProteinID: EGB16454
UniProt: F0JKK5
Position
3640753..3642099
Genome map
AA seq 448 aa AA seqDB search
MSVKKIFLPQDQMPTQWYNPMPDLPTPMAPPLNPETMEPLTPDMLSPIFPDSLIAQEMST
DRFIDIPAEVMDVYRIWRPSPLVRADRLERAIGAKCKIFYKDESVSPAGSHKPNTSVPQA
WYNKTEGVKRLATETGAGQWGTALSFACAQYGMECVVYMVRVSYDQKPYRKMIINTYGGT
IFASPSDQTRTGREMLARDPDCKGSLGLAISEAVEDAATHDDTKYALGSVLNHVLIHQTI
TGLEVQKQLAMIGEKATHLVGCVGGGSNFGGLVLPFLPQKLEGDPVKFIAVEPKACPTLT
RGEYRYDFGDMARLTPLVKMHTLGHDFMPAPIHAGGLRYHGDAPILCNIVHEGLCDPVAY
FQTDCFEAAKLFMQTEGFLPAPETSHAIKGAIEAAKTAGPDDVIVFLYSGHGMLDLASYD
AFNQGLLTNFELPQRDIEQALKSCPVVK
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtgaagaagattttcctgccccaggaccagatgcccacccagtggtacaacccc
atgccggacctgcccacgcccatggccccgcccctcaacccggagaccatggagccgctg
accccggacatgctctcgcccatcttccccgactccctcatcgcccaggaaatgagcacg
gaccggttcatcgacatcccggccgaggtcatggacgtctaccggatctggcggccctcg
cccctggtgcgcgccgaccggctggaacgggccatcggggccaagtgcaagatattctac
aaggacgagtccgtgtccccggcgggttcgcacaaacccaacacctcggtgccccaggcc
tggtacaacaagaccgagggcgtgaagcggctggccaccgagaccggcgcgggccagtgg
ggcacggccctgtccttcgcctgcgcccagtacggcatggagtgcgtggtctacatggtc
cgggtgtcctacgaccagaagccgtaccgcaagatgatcatcaacacttacggcggcacc
atcttcgcctcgccctcggaccagacccgcacgggccgcgagatgctggccagggacccg
gactgcaagggatcgctggggctggccatctccgaggccgtggaggacgcggccacccac
gacgacaccaagtacgccctgggctcggtgctcaaccacgtgctcatccaccagaccatc
accggcctggaggtccagaagcagctggccatgatcggcgagaaggccacccacttggtg
ggctgcgtgggcggcggctccaacttcggcggcctggtcctgcctttcctgccgcagaag
ctcgagggcgacccggtcaagttcatcgcggtggagcccaaggcgtgcccgaccctgacc
cgcggcgagtaccgctacgacttcggcgacatggcccggctgaccccgctggtcaagatg
cacacgctgggccacgacttcatgcccgcgcccatccacgcgggcgggctgcgctaccac
ggcgacgcgcccatcctgtgcaacatcgtccacgaggggctgtgcgacccggtggcctac
ttccagaccgactgtttcgaggcggccaagctgttcatgcagaccgagggcttcctgccc
gcgcccgagacctcccacgccatcaagggggccatcgaggcggccaaaaccgccgggccg
gacgacgtcatcgtcttcctgtactcgggccacggtatgctcgacctggcctcctacgac
gccttcaaccaggggctcctgaccaacttcgagctgccccagcgcgacatcgagcaggcg
ctcaagtcctgcccggtggtcaagtag

DBGET integrated database retrieval system