KEGG   Desulfovibrio desulfuricans ND132: DND132_3253Help
Entry
DND132_3253       CDS       T01709                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddn00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    DND132_3253
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    DND132_3253
Enzymes [BR:ddn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     DND132_3253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3642769..3643911)
Genome map
AA seq 380 aa AA seqDB search
MLARTRNLQAPKSPAMRTRFAALLLLACCLLPAPALAHGADLDTMIGQMILAGFRGFTVN
QRSTIVRDIRERHLGGVILFDYDMFWGAGQRNIRSVEQVRRLVKDLKAGADIPLLVAVDQ
EGGKVQRLKARYGFRETPSAADLGAGSDDAVREAGVVVGADLSSVGFNLNFAPVVDVNVD
PDSPAIGRLGRSFSSDPERVARCAGIFMDELHRARVLSCLKHFPGHGSAGTDSHKGLTDV
TATWSGAELIPYRELIAAGRADMVMTAHIFNARLDPDYPATLSKKVITGLLRGELGFDGV
IVTDDMDMGAIADEYGRREAVRRAIEAGADILLFGNNLSFDEHIVEKVHALIRSMVDDGT
IPKARIEASFARIMRLKRSL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgctggcccggacccgcaacctccaagccccgaagagtcccgccatgcgcacccgtttc
gccgccctgctcctgctggcctgctgcctgctccccgcccccgccctcgcccacggtgcg
gacctggacaccatgatcggccagatgatcctggccgggttccggggattcaccgtgaac
caacgctcgaccatcgtccgcgacatccgcgagcgtcacctgggcggggtcatcctgttc
gactacgacatgttctggggtgccggacagcgcaacatccggtccgtggagcaggtccgc
aggctggtcaaggacctcaaggcgggggccgacattccgctcctggtggccgtggaccag
gagggcggcaaggtccagcggctcaaggcccggtacggttttcgcgagaccccgtccgcc
gcggacctcggggccgggagcgacgacgcggtgcgcgaggccggggtcgtggtcggggcc
gacctgtcgtccgtgggcttcaacctgaacttcgccccggtggtggacgtcaacgtggac
ccggacagcccggccatcggcaggctcgggcgcagcttttcgagcgaccccgaacgggtg
gcccggtgcgccggaatcttcatggacgaactgcaccgggcgcgcgtgctctcctgcctg
aagcacttccccggccacgggtccgccgggaccgactcgcacaaggggctgaccgacgtg
accgccacctggtccggggccgagctcatcccctaccgggagctgatcgcggcaggcagg
gcggacatggtcatgaccgcccacatcttcaacgcccgcctggaccccgactatccggcc
accctgtcgaaaaaggtcatcaccggcctgctgcggggcgaactcggctttgacggcgtg
atcgtcaccgacgacatggacatgggggccatcgccgacgagtacggccgccgggaggcc
gtgcgccgggccatcgaggcgggggcggacatcctcctcttcggcaacaacctgtccttc
gacgagcacatcgtggaaaaggtccacgccctgatccggtccatggtcgatgacggcacc
atccccaaagcgcgcatcgaggcgtccttcgcccggatcatgcggctcaagcggtcgctg
tag

DBGET integrated database retrieval system