KEGG   Desulfovibrio desulfuricans ND132: DND132_3456Help
Entry
DND132_3456       CDS       T01709                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
ddn  Desulfovibrio desulfuricans ND132
Pathway
ddn00860  Porphyrin and chlorophyll metabolism
ddn01100  Metabolic pathways
ddn01110  Biosynthesis of secondary metabolites
ddn01120  Microbial metabolism in diverse environments
Module
ddn_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ddn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DND132_3456
Enzymes [BR:ddn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     DND132_3456
Exosome [BR:ddn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DND132_3456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: EGB16659
UniProt: F0JL60
Position
complement(3841511..3842491)
Genome map
AA seq 326 aa AA seqDB search
MIPMDFYRGRRLRTSAAMRELVREHAVTANDLIMLYFVIDTEDENFKKEIPSMPGQYQLS
LKQLELKVAEAVDNGLKALMLFGIPASKDELGSGAYDDDGIIQKATRRLKARWPELIVMA
DTCLCEYTSHGHCGMVQNQCVLNDPTLNLLARTAVSQARAGADVIAPSDMMDGRVAAIRQ
ALDDEGFTDVPIMSYAVKYASAFYGPFRQAAEGAPKFGDRKTYQMDPPNAREAMREAAAD
LEEGADILMVKPGQPYLDIVRLVRDNFDTPVAAYQVSGEYAMIKAAALNGWIDEQAVVME
SLVGFKRAGADLILSYFTEDVLKVLK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgatacccatggatttctatcgcggacgcaggctgcgcacctcggccgccatgcgtgaa
ctggtgcgggagcatgccgtcacggccaacgacctgatcatgctctacttcgtcatcgac
accgaggacgagaatttcaagaaggaaatcccgtccatgcccggccagtaccagctctcc
ctcaagcagctggaactcaaagtggccgaggccgtggacaacgggctcaaggcgctgatg
ctcttcggcatcccggcctccaaggacgagctgggctccggggcctacgacgacgacggc
atcatccagaaggccacccggcggctcaaggcgcgctggcccgagctgatcgtcatggcc
gatacctgcctgtgcgagtacacctcccacggccattgcggcatggtccagaaccagtgc
gtcctgaacgacccgaccctgaacctgctggcccggaccgccgtgtcccaggcccgggcc
ggggccgacgtcatcgccccgtccgacatgatggacggccgcgtggccgccatccgccag
gccctggacgatgagggcttcaccgacgtcccgatcatgtcctacgcggtcaagtacgcc
tcggccttctacggcccgttccgccaggccgccgagggcgcgcccaagttcggcgaccgc
aagacctaccagatggacccgcccaacgcccgcgaggccatgcgcgaagccgccgccgac
ctggaggaaggcgcggacatcctcatggtcaagcccggccagccctacctggacatcgtc
cggctggtccgcgacaacttcgacaccccggtggccgcctaccaggtcagcggcgaatac
gccatgatcaaggccgccgccctgaacggctggatcgacgaacaggccgtggtcatggaa
tccctggtcggcttcaagcgggccggggcggacctgatcctctcctacttcaccgaagac
gttctcaaggtactgaaataa

DBGET integrated database retrieval system