KEGG   Deinococcus deserti: Deide_00890Help
Entry
Deide_00890       CDS       T00880                                 

Definition
peptidase M42
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ddr  Deinococcus deserti
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ddr00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
99226..100260
Genome map
AA seq 344 aa AA seqDB search
MRLDVLMQLSDLPGVPGQEDAVRDFVLGELEGLADEVRVDALGNVIAFRGAAGEGAARQR
VMISAHMDEIGFLVRFVDDKGFLRVQALGGFDARNLFARNVTVHTRGGKLSGILQPGTKP
VHVASAEERKKIPEIREFFIDLGLDSEEARRQVRIGDMVTLEQSARQVGRLITGKAMDDR
ASVFMLLEVLRHLKGQSLKHDLYAVFSVQEEVGLRGAITAAYGVEPTIGIGLDVTLAIDG
VGGSPEDAVTRLGDGIGIKVFDSSMISTRWLVDEFYDLAESRGIKSQLEVLSMGGTDGGA
IQRSRAGVPTLTLSIPTRYIHTVVESVHEQDVRAGVDLLLAYLA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
ttgcggctggatgtgctgatgcaactttccgatctgcctggcgttccggggcaggaagat
gcggtgcgggacttcgttctgggagaacttgaaggtctggccgacgaggtgcgggtagac
gcactgggcaacgtgatcgccttccgtggtgcagcaggggagggtgcagcgcgtcagcgg
gtcatgatctcggcccacatggacgagatcggatttctggtgcgcttcgtggacgacaag
ggcttcctgcgggtgcaggctctggggggcttcgatgcccgcaacctgttcgcccgcaac
gtcacggtgcacacccgcgggggcaaactcagcggcattctgcagcccggtaccaagccg
gtgcatgtggcctccgctgaggagcgcaaaaagattcccgaaatccgcgaattttttatt
gacctcggactcgacagtgaagaagcccgccgtcaggtgcggatcggggacatggtcacc
ctggagcagagtgctcgtcaggtcggccggctgattaccggcaaggccatggatgaccgc
gccagcgtattcatgttgctcgaagttctgcgtcacctgaagggccagtccctcaagcac
gacctgtatgccgtcttcagtgttcaggaagaggtcggcctgcgtggcgccatcacggct
gcctacggtgtggaacccaccattggcatcggtctggacgtgaccctggccatcgacggg
gtgggtggcagcccggaagacgccgtgacacgtctgggtgacggcatcggcatcaaggtg
tttgattccagcatgatcagcacccgctggctggtggacgagttctacgatctggccgaa
agccgcggcatcaagtcccagctggaggtcctgtcgatggggggcacggacggcggggca
attcagcgcagccgggcaggcgttcccaccctgacactcagcattccgacccgttacatt
cacaccgtcgtggagtcggtgcacgaacaggacgtgagggccggtgtggacctgctgctg
gcctatctggcctga

DBGET integrated database retrieval system