KEGG   Deinococcus deserti: Deide_00890Help
Entry
Deide_00890       CDS       T00880                                 

Definition
peptidase M42
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ddr  Deinococcus deserti
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Deide_00890
Enzymes [BR:ddr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Deide_00890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
99226..100260
Genome map
AA seq 344 aa AA seqDB search
MRLDVLMQLSDLPGVPGQEDAVRDFVLGELEGLADEVRVDALGNVIAFRGAAGEGAARQR
VMISAHMDEIGFLVRFVDDKGFLRVQALGGFDARNLFARNVTVHTRGGKLSGILQPGTKP
VHVASAEERKKIPEIREFFIDLGLDSEEARRQVRIGDMVTLEQSARQVGRLITGKAMDDR
ASVFMLLEVLRHLKGQSLKHDLYAVFSVQEEVGLRGAITAAYGVEPTIGIGLDVTLAIDG
VGGSPEDAVTRLGDGIGIKVFDSSMISTRWLVDEFYDLAESRGIKSQLEVLSMGGTDGGA
IQRSRAGVPTLTLSIPTRYIHTVVESVHEQDVRAGVDLLLAYLA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
ttgcggctggatgtgctgatgcaactttccgatctgcctggcgttccggggcaggaagat
gcggtgcgggacttcgttctgggagaacttgaaggtctggccgacgaggtgcgggtagac
gcactgggcaacgtgatcgccttccgtggtgcagcaggggagggtgcagcgcgtcagcgg
gtcatgatctcggcccacatggacgagatcggatttctggtgcgcttcgtggacgacaag
ggcttcctgcgggtgcaggctctggggggcttcgatgcccgcaacctgttcgcccgcaac
gtcacggtgcacacccgcgggggcaaactcagcggcattctgcagcccggtaccaagccg
gtgcatgtggcctccgctgaggagcgcaaaaagattcccgaaatccgcgaattttttatt
gacctcggactcgacagtgaagaagcccgccgtcaggtgcggatcggggacatggtcacc
ctggagcagagtgctcgtcaggtcggccggctgattaccggcaaggccatggatgaccgc
gccagcgtattcatgttgctcgaagttctgcgtcacctgaagggccagtccctcaagcac
gacctgtatgccgtcttcagtgttcaggaagaggtcggcctgcgtggcgccatcacggct
gcctacggtgtggaacccaccattggcatcggtctggacgtgaccctggccatcgacggg
gtgggtggcagcccggaagacgccgtgacacgtctgggtgacggcatcggcatcaaggtg
tttgattccagcatgatcagcacccgctggctggtggacgagttctacgatctggccgaa
agccgcggcatcaagtcccagctggaggtcctgtcgatggggggcacggacggcggggca
attcagcgcagccgggcaggcgttcccaccctgacactcagcattccgacccgttacatt
cacaccgtcgtggagtcggtgcacgaacaggacgtgagggccggtgtggacctgctgctg
gcctatctggcctga

DBGET integrated database retrieval system