KEGG   Deinococcus deserti: Deide_01030Help
Entry
Deide_01030       CDS       T00880                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ddr  Deinococcus deserti
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deide_01030
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deide_01030
   00052 Galactose metabolism
    Deide_01030
   00500 Starch and sucrose metabolism
    Deide_01030
   00520 Amino sugar and nucleotide sugar metabolism
    Deide_01030
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Deide_01030
   00524 Butirosin and neomycin biosynthesis
    Deide_01030
Enzymes [BR:ddr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Deide_01030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(112523..113434)
Genome map
AA seq 303 aa AA seqDB search
MTNPTLSAQPASIGVDVGGTKIACGVLRGDQLLERHVQPTPETGWEAVLDAIAAQVQQIQ
TAHPDARLIGVGIPGPLNADRTRVKFAPNIYGFTDVPMVDGLRDRLGQRIILENDAKAAA
LAEAHLGAARGAESSVYVTVSTGIGAGIVINGRIWRGRHGIAGELGHVTVMPGGPVSGAG
LDGALEAIASGTAIARDASYTLNREVSTAEAFSLAQQGHPGARRVVMQALKHIGVALADL
QKVLDPEVFVIGGGVASVGDFFFQGVQAAANEYAAGFAPVTIRRAQLGTDAGVIGAALAA
QHG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatcctaccctcagtgcccaacccgccagtatcggcgtggatgtgggcggcacc
aagatcgcctgcggcgtgctgcgcggtgatcagctgcttgagcgccacgtacagcccacc
ccggagaccggctgggaagctgtgctcgacgccatcgccgcccaggtccagcagattcag
accgcgcacccggacgcccgcctgattggcgtggggattccggggcctctgaacgccgac
cggacccgcgttaaatttgcgcccaacatctacggctttaccgacgtgcctatggtggac
ggcctgcgggaccgcctgggccagcgcatcattctggaaaacgacgccaaggcggcggcc
ctggccgaagcccacctgggggcagcccgcggcgccgagagcagcgtgtatgtgacggtc
agcaccggcatcggagccgggatcgtcatcaatggccgcatctggcgcggtcggcacggc
attgccggcgaactgggccacgtcaccgtgatgcccggcggcccggtcagcggcgcaggc
ctggacggcgccctggaggccatagccagtggcactgccattgcccgtgacgccagctat
accctgaaccgtgaggtcagcactgccgaggccttctcgctggctcagcagggtcaccct
ggcgcccggcgtgtcgtcatgcaggccctgaagcacattggcgtggccctggccgacctg
cagaaggttctggacccagaggtcttcgtgatcggcgggggcgtggccagtgtgggcgat
ttcttctttcagggcgttcaggctgctgccaacgaatacgcggccggcttcgcccctgtg
accatccgccgcgcgcagctgggcaccgacgctggtgtgatcggcgccgccctggccgcc
cagcacggctga

DBGET integrated database retrieval system