KEGG   Deinococcus deserti: Deide_01270Help
Entry
Deide_01270       CDS       T00880                                 

Definition
(GenBank) putative Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ddr  Deinococcus deserti
Pathway
ddr00260  Glycine, serine and threonine metabolism
ddr00750  Vitamin B6 metabolism
ddr01100  Metabolic pathways
ddr01110  Biosynthesis of secondary metabolites
ddr01120  Microbial metabolism in diverse environments
ddr01230  Biosynthesis of amino acids
Module
ddr_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Deide_01270
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Deide_01270
Enzymes [BR:ddr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Deide_01270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACO44931
UniProt: C1CYB0
Position
complement(140020..141060)
Genome map
AA seq 346 aa AA seqDB search
MPGLLERYRSYLPVTDRTPLLSLSEGSTPLIYAPHLSQQLGCELYLKYEGLNPTGSFKDR
GMVMAVAKAMEDGADTVICASTGNTSAAAAAYATRAGLRCIVLIPDGNIALGKLAQAMAY
GARIVAINGNFDVALNLVRDISASHPIALVNSVNPYRLQGQKTAAFEIVDELGSAPDILA
IPVGNAGNISAYWMGFREYRSAGRMEALPRMYGFQAAGAAPLARGVDRVENPETLATAIR
IGAPASAHLARAAVSESGGLFDMVTDDEIMEAQQLVAREGVFCEPASAAPVAGLLKRHAA
GQLPAGQRIVAVLTGNGLKDPNSAMRHVATPVAVEAQMDRVLESIL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcccggactccttgaacgttaccgctcttatctgcccgtgaccgaccgcacgcctctg
ctcagcctcagcgaaggcagtacgcccctgatttatgcaccgcacctgagccagcaactg
ggctgtgagctgtacctgaagtacgagggcctgaatcccactggcagcttcaaggaccgc
ggcatggtcatggctgtagccaaagctatggaagacggtgccgacactgtaatctgtgcc
agcaccggcaacaccagtgcggccgcagctgcctatgccacccgcgcgggactgcgctgc
atcgtcttgattcctgacggcaacattgcgctgggcaagctggctcaggccatggcctac
ggagcccgtatcgtggcaatcaacggcaactttgatgttgctttgaatcttgtgcgcgac
atcagtgcctcccaccccattgccctagtcaacagcgtcaacccgtaccgactccagggc
cagaaaacggccgctttcgaaatcgtggatgagctgggcagtgccccggacattctggct
attcctgtaggcaatgccgggaacatcagtgcgtactggatgggcttccgggagtaccgc
agtgccggcaggatggaggctctgcctcgtatgtacgggtttcaggctgccggtgcagcg
ccactggcgcggggggttgaccgggttgaaaatccagagacactggccacagcgatccgt
attggggccccagccagcgctcatttggcccgtgcggcagtcagcgagagcggcggtctg
tttgacatggtgactgatgacgaaatcatggaagcccagcaactggtggcccgcgagggt
gtgttttgcgagccggccagtgctgcgccggtcgccgggctgctcaagcgccatgcagcc
ggacagttgcccgccgggcagcgcatcgtggcagtcctgaccggaaacggcctgaaagat
cccaacagcgccatgcgtcatgtcgcgacaccagtagccgttgaagctcagatggaccgc
gtgttggagagcatcctttga

DBGET integrated database retrieval system