KEGG   Deinococcus deserti: Deide_02730Help
Entry
Deide_02730       CDS       T00880                                 

Definition
PAS:CheB methylesterase:MCP methyltransferase
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
ddr  Deinococcus deserti
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Deide_02730
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Deide_02730
Enzymes [BR:ddr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Deide_02730
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Deide_02730
Two-component system [BR:ddr02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Deide_02730
Bacterial motility proteins [BR:ddr02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Deide_02730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(300126..303155)
Genome map
AA seq 1009 aa AA seqDB search
MNEDAHTATDFPEAPAESRFRTPTAIVGIGGSAGALDSYERLFTALAQGSGMAFVVVPHL
DPQSGSLMPELLARCTSLPVVEITDGLEAAAEHVYVAPPGHTVTLLRGALQLTPDPQPHL
PIDTFFASLAADQGERAVAVVLSGMGIDGSRGVQAIKQNLGLVYVQDPATAQYASMPQSA
VATGTADQVLPAEELAAELFAQVTRTQTLRYPEAFASDGRASASLQKVLNQVRVRTSHDF
SQYKLNTLVRRIDRRMKSQQIQDLEQYAHVLRDNPEEVRALFRDFLINVTSFFRDPQAFE
MVAAHLRTYMREHAESGSFRIWVAGCSTGEEAYSLAMLLREVLEETEDLSHVGVQIFATD
LDQEAVDTARLGLYSTQAVAGVSTERLDRFFIARDGGYQVRSELREMIVFARHNVFRDPP
FTRLDLVSCRNMLIYFSPELQKEVLPLFHFALKPGGLLFLGPSETLGTSREMFGTLDNRW
KLYRREGFRPAGTLALANLSQTPLTIEPQRTSREHHLRFQPARPRESSVSSSVQTVLLAE
WTPPAVAVDAQGTVVYVSGRTGAYLELPNGVPNNNVVDMAFPELRYELIGALREAVATDS
EVRSPVLDFTVQCTPHQLELVVTPMRYPGQPQDLFLIVFLDRGQAPLQSLASAGPDTSGR
VAQLERELQRTKEYLQATIEETEVALEERKSTNEELQTTNEELQSSIEELMTSKEELQSL
NEELSTINAEHHVIITDLQQANDDMKNLLDSVGIATVFLDNNLRVKRFTPRITEVVSLMS
VDLGRPITDIASNLRYDILAEDIQRVIQTLIPYETEVQTKDGRWFLMRISPYRTFDNTID
GAVVVFTNIDTVKQLHHQLRDAQDQNEAVLNTMSDPVVVLDHNLRVLSHNKALLELLQLQ
VADAKGVRLFDLGSGQFDNPELTGLLRDLTLGSGELSDFMLHMDLPGQGRRIVKVNARPL
QTHDERAELLLWAEDVTPIIQQLAEEGPGAIHETTSSEADSGAQAPDQN
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagacgcccacaccgccactgactttcctgaggcacctgctgaaagccggttc
agaacgccgaccgccattgtcggaatcggcggctcggccggcgcactggacagttacgaa
cgcctgtttacggcgcttgcccagggcagcggcatggccttcgtggtggtgccgcacctg
gatccgcagagcggcagcctgatgccggaactgctggcccgctgcacctccctgccggtg
gtggaaatcaccgacggcctggaagccgccgccgaacacgtctatgtcgcgccgcccggc
cacacggtgaccctgctgcgcggcgccttgcaactgacccccgacccccagcctcacctg
cctatcgacacgttctttgccagcctcgccgccgatcagggcgaacgggccgtggctgtg
gtgctgtcgggcatgggcattgacggcagccgtggcgtgcaggccatcaagcagaacctg
gggctggtgtacgtgcaggatccggcgaccgcgcagtacgccagcatgccgcagagcgcc
gtggccaccggcaccgccgatcaggtgctgccggccgaagaactggcggccgagctgttt
gcccaggtgacccgcacccagaccctgcgttacccggaggcgtttgccagtgacgggcgc
gcttcggcctcgttgcagaaggtgctcaatcaggtccgggtccgcacgtcgcacgacttt
tcccagtacaagctcaatacgctggtgcgccgcatcgaccggcgcatgaaaagtcagcag
atccaggacctcgaacagtacgcccatgtcctgcgcgacaatcccgaagaggtccgggcg
ctgttccgggacttcctgatcaacgtgaccagctttttccgcgatccgcaggcgttcgag
atggtagcggcccatctgcggacctatatgcgggagcacgccgagtcgggcagtttccgg
atctgggtggcgggctgctccacaggagaggaagcctattcgctggccatgctgctgcgc
gaggtgcttgaggaaaccgaggacctctcgcacgttggggtacagatctttgccaccgac
cttgatcaggaggccgtggacaccgcccggctgggcctgtactccacacaggctgtggca
ggcgtgtccaccgagcggctggaccggtttttcattgcgcgcgacggcggctatcaggtc
aggagcgaactgcgcgagatgatcgtgtttgcgcggcacaacgttttccgggacccgccg
tttacccgcctggacctggtgtcgtgccgcaacatgctgatctatttcagccccgagctg
caaaaggaagtgctgccgctgtttcacttcgccctgaaacccggcggcctgttgttcctg
ggaccgtccgagacactgggcaccagccgggagatgttcggcaccctggacaaccgctgg
aagctctaccggcgtgagggcttccggcccgcaggaacactggcgctggccaacctgagc
cagacaccgttgacaatcgagcctcagcggacgtcccgcgagcatcacctgcgcttccag
cctgcccgcccacgggaaagtagcgtgtccagcagtgtgcagactgtgctgctggccgag
tggacgcccccagccgtcgccgtggacgcccagggcactgtggtgtatgtcagcggccgg
accggagcctacctggagctgccgaacggcgtccccaacaacaatgtggtggatatggcc
ttcccggagctgcgctacgaactgatcggcgcgctgcgcgaagccgtggccaccgacagc
gaggtccgctcgccggtgcttgatttcaccgttcaatgcacgccgcaccagctggaactg
gtagtgacccccatgcgctacccaggtcagcctcaggacctgtttctgattgtctttctg
gaccgggggcaggcgccgctgcaaagcctggccagtgccgggccggacaccagcggccgg
gtggcgcagctggagcgcgaactccagcgcaccaaggaatacctgcaggccaccatcgag
gagacggaagtggcgcttgaggaacgcaaaagcaccaatgaggaactccagaccaccaac
gaggaactccagagcagcatcgaggagctgatgacctccaaagaggagttgcagtcgctc
aacgaggagctcagcaccatcaacgccgaacatcacgtgatcatcacggatctccagcag
gccaacgacgatatgaaaaacctgctggactcggtgggcattgccaccgtgttcctggac
aacaacctgcgggtcaagcggtttacgccgcgcattaccgaagtggtcagtctgatgtcg
gtggatctggggcgaccgatcaccgatatcgcctcgaacctgcgctacgacatcctggcc
gaggacattcagcgcgtgatccagactctgattccctatgaaacagaggtccagaccaag
gacggccgctggttcctgatgcgcatttcgccctaccggaccttcgataacaccatcgac
ggcgccgtggtggtctttaccaatatcgacaccgtcaagcagctgcaccaccagctgcgc
gacgctcaggaccaaaacgaagctgtgctgaataccatgagtgacccggtcgtggtgctc
gaccataacctgcgggtgctgtcgcacaacaaggccctgctggagctgctgcagcttcag
gttgccgacgcaaagggcgtgaggctctttgacctgggcagcgggcagttcgacaatcca
gagctgacgggcctgttgcgcgacctgacgctgggcagcggcgaactgagcgatttcatg
ctgcacatggaccttcccggtcagggccgacggatcgtcaaagtcaatgcgcgccccctc
cagacccacgacgagcgcgccgaactgctgctgtgggcagaggacgtcacgccgatcatt
cagcagcttgccgaagagggtcccggagccattcacgaaacgacatcatccgaagcggac
agcggagcacaggcccctgatcagaactga

DBGET integrated database retrieval system