KEGG   Deinococcus deserti: Deide_02960Help
Entry
Deide_02960       CDS       T00880                                 

Gene name
rocF
Definition
(GenBank) putative Arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
ddr  Deinococcus deserti
Pathway
ddr00220  Arginine biosynthesis
ddr00330  Arginine and proline metabolism
ddr01100  Metabolic pathways
ddr01110  Biosynthesis of secondary metabolites
ddr01130  Biosynthesis of antibiotics
ddr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Deide_02960 (rocF)
   00330 Arginine and proline metabolism
    Deide_02960 (rocF)
Enzymes [BR:ddr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Deide_02960 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACO45114
UniProt: C1CZ76
Position
complement(330533..331432)
Genome map
AA seq 299 aa AA seqDB search
MNISILGIPMDLGAGRRGVDMGASALRNAHLAAHLRRLGHTVTDLGDIPVPIPETVDKHL
TGGLVFLEQIQHTSQVTTQRVAALGADVFPITLGGDHSISMGTVTGNALRGQPEGVRTGV
IWVDAHSDYNTPQSSPSGNIHGMPVAHLTGLGDPVLSNLGGLWQLRAEDIVMIGIRSVDS
LERELLREAGIKAYTMKDVDQLGMTRIHAETMERLSAVERIHVSFDADALDPSVAPGVGT
PVPGGLTYREGHLLMELLCESGRVTSMDIVEVNPVLDTHNQTAEVMVGMAASLLGQRIL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgaatatttcgattctgggcattccaatggatctgggcgctggacgccgtggggtggac
atgggcgcctccgcactccggaacgcccaccttgctgcccacctgcgccggctggggcat
acggtaaccgaccttggcgacataccggtgccgattcctgagacggtagataagcacctg
actggtgggctggtgtttctggagcagattcagcacacctcgcaggtcaccacccaacgt
gtggccgccctgggcgcagatgtctttcccattactctgggtggtgaccacagcatcagc
atgggcaccgtgaccggcaacgccctgcgtggtcagccggaaggcgtgcgcaccggggtg
atctgggtggacgcccacagcgactacaacaccccgcagagcagtcccagcggcaatatt
cacggcatgccggtcgctcacctgactggcctgggagacccggtgctgtccaacctgggc
gggctgtggcagctgagggccgaagacatcgtgatgatcgggatccgcagcgtggacagc
ctggagcgtgaactgttgcgcgaggcaggcatcaaggcctacaccatgaaggatgtggat
cagctggggatgacccgtatccatgccgagaccatggagcggctctccgctgtcgagcgt
atccatgtctccttcgacgccgacgccctggacccctccgtggccccaggggtcggcaca
ccggtgccgggtggcctgacctaccgcgaaggccatctgctgatggagttgctgtgcgaa
tccggtcgtgtcaccagcatggatatcgtagaggtcaacccggtgctcgacacccataac
cagacggcagaagtgatggtaggtatggctgccagcctgctgggccagcgcattctgtaa

DBGET integrated database retrieval system