KEGG   Deinococcus deserti: Deide_03051Help
Entry
Deide_03051       CDS       T00880                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ddr  Deinococcus deserti
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Deide_03051
Enzymes [BR:ddr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Deide_03051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
341421..341939
Genome map
AA seq 172 aa AA seqDB search
MSVSNDAYVALGANLGDAHGTLCWAREAVTSLGDVHASSRLYRTAPVGGPPGQPDYLNAA
LHLRTSLDPHALLQALHRLEDQAGRERRERWEARVLDLDLLLYGDQVHAGPLLTLPHPRA
WERGFVLCPLNDLNPALAHPLTGETVAQALKRVELTGVSVAGLEWSPFRGHR
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
ctgagcgtctctaatgacgcctacgtcgcgctgggagcgaatctgggcgacgcccacggc
acgctgtgctgggcccgtgaagccgtcaccagcctgggggacgtgcacgcgtcatcgcgt
ttgtaccgcacggccccggtgggtggtccccctggccagccggactacctgaacgctgcg
ctgcacctgcggacaagtctcgacccgcacgcgctgctccaggccctgcaccgtctggag
gaccaggccgggcgggaacgtcgtgagcgctgggaggcgcgggtgctggacctggacctg
ctgctgtatggcgatcaggttcatgcgggcccccttctcacactgccgcatccccgtgcc
tgggagcgggggtttgtgctgtgcccccttaacgatctgaacccggctctggctcatcca
ttgactggggagaccgtggcgcaggcgctgaagcgggtggagcttaccggtgtaagtgtg
gctgggctggaatggtctcccttcaggggacacagatag

DBGET integrated database retrieval system