KEGG   Deinococcus deserti: Deide_03170Help
Entry
Deide_03170       CDS       T00880                                 

Gene name
aceF
Definition
dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, (E2), (dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ddr  Deinococcus deserti
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:ddr01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ddr00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ddr00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ddr00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
353470..355332
Genome map
AA seq 620 aa AA seqDB search
MATQLNLPDVGDNIEKGTVVTVLINPGDTVTEGQPIIEIETDKAVVEVPASASGTVEAVN
VKVGDTVPVGGLIATLGGGTASGAAPATADAGAAKTGNLPDNAAEPDSSTVADQAETAHR
VAAAQVESQKEQAHQGGGQVPAASAPAPQQAAPAAGGSAQQVTLPDVGDNIEQGIIVSIL
VNVGDTVTEGQPVVELETDKAVVEVPSSAAGTVEAVNVKVGDPVRIGGVLLTLAGGAPAA
AAPAAQDNAPAQAAPAQSAPAQDAPATASLSSERPAAANSASLPPERAQPATQQPGAERP
YNTQSYDGRQLIPAAPSVRRLARELRVDIYEVQGTGIAGRISEEDVRRTLAGTQGQTTAA
ASAAPAAQAAAAPRAAAPVALPNFEKWGGVRREDMSGIRKATVRSMTASWSTIPMVTHFD
KADVTLMEETRKRFAARVEKAGGKLTMTHILMKVVANALHKFPKFGASLDLAAEQVVYKD
YVNIGVAVDTPVGLLVPVVKDADRKSITDLVLELSELAGRARDRKLKPDEMQGATFTISN
LGGIGGHAFTPIVNSPEVAILGVSRGGFEPVWNKETSSFEPRNMLPVSLTYDHRLIDGAD
AARFVRFICESLEDPFLISL
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atggcgacccagctgaacctccccgacgtgggggacaacatcgagaaaggtacggtcgtg
accgtgctgatcaacccgggtgacaccgtcaccgaaggccagccgatcattgagatcgag
accgacaaggccgtggtcgaagtaccggccagtgcgtcaggaaccgtagaagccgtgaat
gtgaaggtcggagacaccgtgccggtgggcggcctgattgccacgctggggggcggaact
gcctctggtgccgcaccagccaccgctgacgcaggagccgcgaagactggcaacctgccc
gacaacgccgccgagccggattccagcaccgtagcggatcaggcagaaacggcccaccgt
gtcgcagctgcccaggtggaaagccagaaggaacaggcgcatcagggtggggggcaggtg
ccggcagccagtgcgccagccccgcagcaggctgcaccggccgctggtggctcagcccag
caggtcacgctgccggacgttggagacaacatcgagcagggcatcatcgtgtccattctg
gtcaacgtcggggacacggtcaccgagggccagccggtggtggaactggagaccgacaag
gccgtggtcgaggtgccttccagtgcggccggcaccgttgaggctgtgaatgtgaaggtc
ggagacccggtgcggatcggtggcgtgctgctcacgctggcaggaggagctccggcagcg
gcggcgcccgcagctcaggacaacgcaccagctcaggcagctcccgcccagtccgctcct
gcgcaggacgcgccggccaccgccagtctcagtagcgaacgccccgctgcagccaacagt
gccagtctgccgccggaacgcgcccagcccgccacccagcagccgggagccgagcgtccc
tacaacacccagtcctacgacggccgccagctcattcctgcggctcccagtgtgcggcgc
ctggcgcgggaactgcgcgtggacatttatgaggtgcagggcaccggcattgccgggcgc
atcagcgaggaagacgtgcggcgcaccctggctggcactcagggccagacgactgctgct
gcgtcggctgctccagcggcccaggcagctgccgcgccccgcgctgctgcacctgtggct
ctgcccaacttcgagaagtggggtggggtgcgccgcgaggacatgagcgggatccgcaag
gccaccgtgcgctccatgaccgcctcctggagcaccattcccatggtcacgcacttcgac
aaggccgacgtgaccctgatggaagaaacccgcaagcgcttcgcggcgcgcgtggaaaag
gccggcggcaagctgaccatgacccacatcctgatgaaggtcgtggccaatgcgctgcac
aagttccccaagttcggcgcgagcctggatctggccgccgagcaggtggtgtacaaggat
tacgtgaacatcggcgtggccgtggacaccccggtgggcctgctggtcccggtcgtcaag
gacgctgaccgcaagagcatcaccgacctggtgctggaactcagcgaactggccgggcgt
gcccgtgaccgcaagctcaagcctgacgagatgcagggtgcgacctttaccatcagcaac
ctgggaggcattggcgggcacgccttcacgcccatcgtgaactcgcccgaggtggccatc
ctgggagtctcacgcggcggcttcgagccggtgtggaacaaggagaccagcagcttcgag
cctcgtaacatgctgccggtctcgctgacctacgatcaccgcctgatcgacggtgcggac
gctgcccgcttcgtgcgcttcatctgcgagtcgctggaagatcctttcctgatctcgctc
tga

DBGET integrated database retrieval system