KEGG   Deinococcus deserti: Deide_03550Help
Entry
Deide_03550       CDS       T00880                                 

Gene name
adh
Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
ddr  Deinococcus deserti
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Deide_03550 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deide_03550 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    Deide_03550 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Deide_03550 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Deide_03550 (adh)
   00626 Naphthalene degradation
    Deide_03550 (adh)
Enzymes [BR:ddr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Deide_03550 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
398875..399918
Genome map
AA seq 347 aa AA seqDB search
MKAVMVHAFNVRPELVTVSDPTPPEDGVVVQVGATGVCRSDWHGWVGHDPDITLPHVPGH
ELAGTVVAVGKNIRRWKVGDRVTVPFVSGCGRCHECQSGNQQVCDRQFQPGFTHWGSFAE
YVALHQAEQNLVALPDDLDFVTAASLGCRFATSFRAVVHQGRVRAGEWVAVHGCGGVGLS
AIMIAKALGAGVVAVDIDEEKLRFAGQLGADLLINSRATPDVAGAVRDLTGGGVHVSLDA
LGHPETCANSVANLRTRGRHVQVGLLLAEQSRPAIPMDRVIARELELYGSHGMAAHAYPE
MLAMISRGALRPDQLLGQRVTLEQSIDVLVNMDRFVERGVTVIDRFV
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgtcatggttcatgcgttcaatgttcgccctgagctcgtcacggtttctgat
cccacgcctcctgaagatggcgtggtggtccaggtgggcgccacaggcgtgtgccgcagc
gactggcatggatgggtggggcacgacccggacatcacccttccgcatgttccgggacac
gagctggccggaacggtcgtggctgtcggcaaaaacatccgcagatggaaggtcggcgac
cgggtcaccgtcccgttcgtttccggctgcgggcgttgccacgaatgtcagtctgggaac
cagcaggtgtgtgaccgccagtttcagcctggttttacccactggggctcgttcgccgag
tatgtggcgctccaccaggccgagcagaacctcgtggccctgccggatgatctggatttc
gtgacggctgcgagtctgggatgccgctttgctacgtccttccgggctgtggttcatcag
gggcgcgtccgggctggtgaatgggtggcggtccacggctgcggcggggtcggcctgtcg
gccatcatgattgccaaggccctgggtgccggggtggtggcggtggatatcgatgaggaa
aaactccggtttgccgggcagctgggagcagaccttctgatcaacagccgcgcgaccccg
gatgtcgccggagcggtccgggacctgacaggtggtggtgtgcacgtgtccctggacgcc
ctggggcacccggagacctgcgcgaactctgttgcgaacctcaggacacgtggacgtcac
gtgcaggtgggtctgctgctggccgagcagagccgccccgccattccgatggaccgggtg
atcgcgcgcgaactggaactgtacggcagtcatggtatggctgcccatgcctatccggag
atgcttgccatgatcagccgaggcgccctcaggccggatcagctgcttgggcagcgggtc
acgctggagcagtctatcgacgtgctggtaaatatggaccgtttcgtggaacgcggcgtg
accgtaatcgaccggttcgtgtaa

DBGET integrated database retrieval system