KEGG   Deinococcus deserti: Deide_03630Help
Entry
Deide_03630       CDS       T00880                                 

Definition
(GenBank) putative Endoglucanase; putative M42 peptidase
Organism
ddr  Deinococcus deserti
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(407377..408504)
Genome map
AA seq 375 aa AA seqDB search
MPENHNHPGAEAGHGDSPALAHLRHLVRLTGPSGSEEDVIRAVHHAAAALADHTEVDAFG
NVIAIRRAASEGARRVIVAAHMDEVGFRVRQITPTGFLRLEKVGGTDDRILPAQRVWVRT
QQGRLMGVIGTKSAHLLTDTDRQRIVPAPELYVDIGARNADEAIGMGVHLGDPVGFVGVL
TELGQNTGRYTAHAVDDRAGCAVMLALLERYQDSPPPVTVIFAFTVQEEVGLRGAQAVAS
AYKADVALALDMTAADDTPELGTCHLQLGAGPAVKVMDFSTMAHPAVRRGLIAAADAGGI
AVQHELLRGIGTDAGALQYGSQGIPTGAVSVANRYTHSPVEVVDERDLSGALELLDHFIQ
RLPDLDLRFVALSDT
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaaaccacaaccacccgggcgcagaagcaggccacggtgattcgcccgccctt
gcgcatctgcgtcaccttgtccggctcaccggacccagcggcagtgaggaggacgttatc
cgggccgtccaccatgccgctgccgcgctggccgatcacacggaggtggacgccttcggg
aatgtcattgccatccggcgcgccgccagcgagggagcacgccgggtgattgtcgcggca
cacatggacgaggtcggcttccgggtcaggcagatcacccccaccgggtttctgcggctg
gaaaaagtaggcggcaccgatgaccgcatcctgcctgcacagcgcgtctgggtgcgcacg
cagcagggccggctgatgggcgtgatcggcacaaaaagtgcccacctgctgactgacacc
gaccggcaacggatcgtgcccgcacccgaactgtatgtggatattggcgcgcgcaatgcg
gacgaagccatcggcatgggggttcatctgggagatccggtcggattcgtgggggtgttg
accgaactgggtcagaacaccggccgttacacagcccacgcggtagatgaccgggccggc
tgcgccgtgatgctggccctgctggaacggtaccaggacagccctccgccggtcacggtc
atctttgccttcacggtgcaggaggaggtcgggctgcgcggcgctcaggcggtggccagc
gcctacaaggccgacgtggccctggctctggacatgacggccgccgacgatacgcctgag
ctggggacctgccaccttcagctgggagccgggccggccgtgaaggtgatggacttctcg
accatggcgcatccggcagtgcggcgcggcctcatcgctgctgcggacgcgggcgggatc
gctgtacagcacgaactgctgcgcggcattggcaccgacgccggggccctgcagtacgga
agccagggcataccgaccggcgcggtatcggtggccaaccgctatacccacagccccgta
gaggtggtggacgaacgcgacctcagcggcgccctggagttgctggaccactttatccag
cgtctgccggacctggatctgcgcttcgtggcgctgagtgacacctga

DBGET integrated database retrieval system