KEGG   Deinococcus deserti: Deide_04080Help
Entry
Deide_04080       CDS       T00880                                 

Definition
(GenBank) putative Magnesium protoporphyrin chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
ddr  Deinococcus deserti
Pathway
ddr00860  Porphyrin and chlorophyll metabolism
ddr01100  Metabolic pathways
ddr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Deide_04080
Enzymes [BR:ddr01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Deide_04080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma54_activat AAA_5 AAA_3 Mg_chelatase AAA_PrkA
Motif
Other DBs
NCBI-ProteinID: ACO45234
UniProt: C1CZY2
Position
complement(464904..466355)
Genome map
AA seq 483 aa AA seqDB search
MTALAKARTLGELLESPEYAGRRPFDGRVRLVQDEVRDNLTRKLRSGEELFPGVVGYDET
VIPQLINALLARQNFILLGLRGQAKSRILRAITGLLDEVVPVIDGVDMPDDPLNPVGAEG
RHLLEAHGLELPVRWLPRADRFVEKLATPDVTVADLIGDVDPIKAARLGTSLGDTRSMHF
GLLPRANRGIFAVNELADLAPKVQVALFNILQEGDVQIKGYPIRLELDVMLVFSANPEDY
TARGKIVTPLKDRIGSEIRTHYPTDVRQGMEITAQEAVRAEGIIVPPFIAELIEEIAFQA
REDGRVDKLSGVSQRLPISLMELGAANAERRSLVAGDAPVVRVSDVYAGLPAITGKMELE
YEGELKGADNVARDVIRKAAGVVYARHYGSADTRELEKWFDQGNVFRFPQGGDAASALKA
ADEVPGLTALAAEVAGSADDAVRAAAAEFILEGLYGRKKLSRAEELYAAPEPELKQGRGG
RWN
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgactgcacttgcaaaagccaggacgctgggggaattactcgagtcgccggagtatgcg
gggcgccggccttttgacggccgggtccggctggtgcaggacgaggtacgcgacaacctg
acccgcaagctcagaagcggcgaggagctgttcccgggcgtggtcggttacgacgaaacc
gtgattccgcagctgatcaacgccctgctggcccgccagaactttattctgctgggcctg
cgcggccaggccaagagccgcatcctgcgcgccatcactgggctactggacgaggttgta
ccggtcattgacggcgtggacatgcccgacgatcccctgaacccggtgggcgccgaaggg
cggcacctgctcgaagctcacgggctggagttgccggtccgctggctgccgcgcgcggac
cgctttgtggagaaactggccacgcccgacgtcacggtcgccgacctaatcggggacgtg
gaccccatcaaggcggcccggctgggcaccagcctgggggatacacgcagcatgcacttc
gggctgctgccgcgcgccaaccgcgggatttttgccgtgaacgaactggcagacctggcg
cccaaggtacaggttgcgctgttcaacatccttcaggaaggggacgtgcagatcaagggc
tacccgatccgcctggagctcgacgtcatgctggtcttctcggccaacccggaagactac
accgcgcgcggcaagatcgtcacgccgctcaaggaccgcatcggcagtgaaattcgtacg
cactaccccacagacgtgcgtcagggtatggaaatcactgcccaggaagccgtgcgggcc
gagggcatcattgtgccgccctttattgccgagctgatcgaagaaattgctttccaggcc
cgtgaggacggccgcgtggacaagctcagcggggtttcgcagcgcctgccgatctctctg
atggaactgggcgccgccaacgccgaacgccgcagcctggttgccggtgacgccccggtg
gtgcgggtcagcgacgtgtacgccggactgcccgccattaccggcaagatggagctggag
tacgaaggcgagctcaaaggggcggacaacgttgcccgtgatgtgattcgcaaggcggcc
ggagtggtctacgcgcggcactacggcagcgcggacacccgtgagctggaaaaatggttt
gatcagggcaacgtgttccgcttcccccagggtggggacgctgccagcgccctgaaagcc
gccgatgaggttcccgggctgactgctctggccgccgaggtcgctggcagtgccgatgac
gccgtgcgcgccgccgcggccgaatttatccttgaggggctgtatggccgcaagaaactc
agccgcgccgaggaactgtacgctgcgccggagccggaactgaagcagggccgtgggggc
cgctggaactga

DBGET integrated database retrieval system