KEGG   Deinococcus deserti: Deide_04080Help
Entry
Deide_04080       CDS       T00880                                 

Definition
Magnesium protoporphyrin chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
ddr  Deinococcus deserti
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Deide_04080
Enzymes [BR:ddr01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Deide_04080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(464904..466355)
Genome map
AA seq 483 aa AA seqDB search
MTALAKARTLGELLESPEYAGRRPFDGRVRLVQDEVRDNLTRKLRSGEELFPGVVGYDET
VIPQLINALLARQNFILLGLRGQAKSRILRAITGLLDEVVPVIDGVDMPDDPLNPVGAEG
RHLLEAHGLELPVRWLPRADRFVEKLATPDVTVADLIGDVDPIKAARLGTSLGDTRSMHF
GLLPRANRGIFAVNELADLAPKVQVALFNILQEGDVQIKGYPIRLELDVMLVFSANPEDY
TARGKIVTPLKDRIGSEIRTHYPTDVRQGMEITAQEAVRAEGIIVPPFIAELIEEIAFQA
REDGRVDKLSGVSQRLPISLMELGAANAERRSLVAGDAPVVRVSDVYAGLPAITGKMELE
YEGELKGADNVARDVIRKAAGVVYARHYGSADTRELEKWFDQGNVFRFPQGGDAASALKA
ADEVPGLTALAAEVAGSADDAVRAAAAEFILEGLYGRKKLSRAEELYAAPEPELKQGRGG
RWN
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgactgcacttgcaaaagccaggacgctgggggaattactcgagtcgccggagtatgcg
gggcgccggccttttgacggccgggtccggctggtgcaggacgaggtacgcgacaacctg
acccgcaagctcagaagcggcgaggagctgttcccgggcgtggtcggttacgacgaaacc
gtgattccgcagctgatcaacgccctgctggcccgccagaactttattctgctgggcctg
cgcggccaggccaagagccgcatcctgcgcgccatcactgggctactggacgaggttgta
ccggtcattgacggcgtggacatgcccgacgatcccctgaacccggtgggcgccgaaggg
cggcacctgctcgaagctcacgggctggagttgccggtccgctggctgccgcgcgcggac
cgctttgtggagaaactggccacgcccgacgtcacggtcgccgacctaatcggggacgtg
gaccccatcaaggcggcccggctgggcaccagcctgggggatacacgcagcatgcacttc
gggctgctgccgcgcgccaaccgcgggatttttgccgtgaacgaactggcagacctggcg
cccaaggtacaggttgcgctgttcaacatccttcaggaaggggacgtgcagatcaagggc
tacccgatccgcctggagctcgacgtcatgctggtcttctcggccaacccggaagactac
accgcgcgcggcaagatcgtcacgccgctcaaggaccgcatcggcagtgaaattcgtacg
cactaccccacagacgtgcgtcagggtatggaaatcactgcccaggaagccgtgcgggcc
gagggcatcattgtgccgccctttattgccgagctgatcgaagaaattgctttccaggcc
cgtgaggacggccgcgtggacaagctcagcggggtttcgcagcgcctgccgatctctctg
atggaactgggcgccgccaacgccgaacgccgcagcctggttgccggtgacgccccggtg
gtgcgggtcagcgacgtgtacgccggactgcccgccattaccggcaagatggagctggag
tacgaaggcgagctcaaaggggcggacaacgttgcccgtgatgtgattcgcaaggcggcc
ggagtggtctacgcgcggcactacggcagcgcggacacccgtgagctggaaaaatggttt
gatcagggcaacgtgttccgcttcccccagggtggggacgctgccagcgccctgaaagcc
gccgatgaggttcccgggctgactgctctggccgccgaggtcgctggcagtgccgatgac
gccgtgcgcgccgccgcggccgaatttatccttgaggggctgtatggccgcaagaaactc
agccgcgccgaggaactgtacgctgcgccggagccggaactgaagcagggccgtgggggc
cgctggaactga

DBGET integrated database retrieval system