KEGG   Deinococcus deserti: Deide_06630Help
Entry
Deide_06630       CDS       T00880                                 

Gene name
ppgK
Definition
(GenBank) putative polyphosphate--glucose phosphotransferase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
ddr  Deinococcus deserti
Pathway
ddr00010  Glycolysis / Gluconeogenesis
ddr00520  Amino sugar and nucleotide sugar metabolism
ddr01100  Metabolic pathways
ddr01110  Biosynthesis of secondary metabolites
ddr01120  Microbial metabolism in diverse environments
ddr01130  Biosynthesis of antibiotics
ddr01200  Carbon metabolism
Module
ddr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deide_06630 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    Deide_06630 (ppgK)
Enzymes [BR:ddr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Deide_06630 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ACO45517
UniProt: C1D0Z3
Position
812025..812882
Genome map
AA seq 285 aa AA seqDB search
MSVILGIDIGGSGIKGAPVNVSTGQLAGERHRIPTPEGARPDDVVRVVAQLVEHFGLDGP
VGVTFPGIVQHGHTLSAANVDKGWIGLDADALFTQATGRDVRLLNDADAAGLAEAKFGAG
RGVDGTVLVLTFGTGIGSALVHNGVLVPNTELGHLWLREHHAETWASDRARERDDLNWKQ
WSKRVSGYLQHLELLFSPDLFIIGGGVSKKAEKWQDHIRLERSRLIPAALQNEAGIVGAA
LLAAQPAPPAPLVSPALRPARVAGRTEAVPVPVKPSKDKARRKSS
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgattctgggcatcgatatcggcggcagcgggattaagggtgcacccgtcaac
gtcagcaccgggcagctggccggcgagcgccaccgcattcctaccccggagggtgctcgt
cctgacgatgtcgtgcgtgtggttgcacagctcgtagagcattttggccttgacgggcct
gttggggtgaccttcccggggatcgtgcagcacggccacaccctgagtgccgccaacgtg
gacaagggctggatcggcctggacgccgacgccctgttcacccaggccacgggccgggat
gtccggctgctcaacgacgccgacgctgccgggctggctgaggcgaaattcggcgctggc
cgcggcgtggacggcaccgtactggtgctgaccttcggcacaggtattggcagcgctctc
gttcataacggcgttctggttcccaataccgaactgggccatctgtggctgcgcgagcat
catgctgaaacctgggcatctgaccgtgcacgtgagcgtgacgacctgaactggaaacaa
tggagcaagcgggtcagcggttacctgcagcacctggaactgctgttcagcccggacctg
ttcatcatcggcggcggggtgagcaagaaagccgagaagtggcaggaccatatccggctg
gagcgcagccgccttatcccagctgccctccagaatgaagcgggaattgtaggggccgcg
ctgctggccgctcagcccgcgccgcctgccccgctcgtgtcaccggctctgagacccgca
cgggttgctggccgcacagaagcagttcctgtacctgtcaaaccttccaaagacaaggcg
cgtcgcaagtccagctga

DBGET integrated database retrieval system