KEGG   Deinococcus deserti: Deide_07760Help
Entry
Deide_07760       CDS       T00880                                 

Gene name
sodA
Definition
superoxide dismutase
Orthology
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ddr  Deinococcus deserti
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
949525..950148
Genome map
AA seq 207 aa AA seqDB search
MAYELPQLPYAYDALEPHIDTRTMEIHHTKHHQAYVDNANKALEGSELASLPVEELIQKL
DQVPADKKTALRNNAGGHANHSLFWQVMGPGQGGQPSGELMEAINAAFGSFEAFKTKFED
AAKTRFGSGWAWLVVKDGSLTVVSTANQDNPLMGEAIAGVSGTPVLGVDVWEHAYYLNYQ
NKRPDYLTAFWNVVNWDEVSRRYAAAR
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgaacttccccagttgccctacgcctacgacgccctggaaccccacattgac
acccgcaccatggaaatccaccacaccaagcaccaccaggcttatgtggataacgccaac
aaggcgcttgaaggcagtgaactggccagcctgccagttgaggaactgatccagaaactc
gatcaggtgcctgccgacaagaagactgccctgcgtaacaacgctggtggacacgccaac
cacagcctgttctggcaggtcatgggcccgggtcaaggtggtcagcccagcggcgaactg
atggaggcgatcaacgctgccttcggttccttcgaagccttcaaaacgaagtttgaagac
gccgccaagacccgcttcggctccggctgggcgtggctggtcgtcaaggacggcagtctg
accgtcgtgagcactgccaaccaggacaacccactgatgggagaagccatcgctggagtc
agcggcactccggtcctgggtgtggacgtctgggagcacgcctactacctcaactaccag
aacaagcgtcccgactacctcactgcgttctggaacgtcgtgaactgggacgaagtcagc
cgccgttacgctgctgccaggtaa

DBGET integrated database retrieval system