KEGG   Deinococcus deserti: Deide_08170Help
Entry
Deide_08170       CDS       T00880                                 

Definition
cytochrome P450
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
ddr  Deinococcus deserti
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    Deide_08170
  Amino acid metabolism
   00380 Tryptophan metabolism
    Deide_08170
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Deide_08170
Enzymes [BR:ddr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     Deide_08170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(998735..999952)
Genome map
AA seq 405 aa AA seqDB search
MADPAFVADPYPLLTELRESSPVFYDRGMNRVVLTRHADISALLRDRRFGRSALHRYSRD
ELGWPPADPRQANFDAFNSNHLLDSEPPKHTRLRSLVQLAFTPKRVERLQGRIEDILAAQ
LEGLRPGSSFDLVERYAEPLPVIVIAELLGVPEEARGHLRPWSAAIVKLYEPGVSPQAQA
EAEQAVLDFSALLRELVALRRTRPQDDLITALVQAEEGGDRLTEQELIDTCILLLNAGHE
ASVNGLSAGVLALLRQPEHWQALVEAAPREDSLPLFRLAIEELLRYDTPLPMFERIALEK
MQLFGTDLRPGDRVALLYASGNRDPRRFERPNELVLSRDPNPHLTFGLGIHYCLGAPLAR
LELALSLRALCRAMPDLRLNDPDGSAHYTGGFVIRGLARLDVRSG
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
ttggcagacccggctttcgtggctgatccctatcccctgctgactgaactgcgggagtcg
tcccctgtcttttatgaccggggcatgaaccgggtggtgctgacccgccatgccgacatc
agtgccctgctgcgcgaccgcagattcggacgcagcgccctgcaccgttattcccgtgat
gaactggggtggcctccagccgacccgcggcaggccaacttcgacgctttcaacagcaac
catctgctcgacagcgagccgcccaagcacacccgcctgcgctctctggtgcagctggcc
ttcacaccaaagcgggttgagcgcctgcagggccgcatcgaggacattctggctgcgcag
cttgagggtctgcggcccgggagttccttcgatctggtcgagcgctacgcggagcctctt
ccggtgatcgtgattgctgaactgctcggcgtgcctgaggaagcgcgggggcacctgcgg
ccctggtcggccgcgatcgtgaaactctacgaacctggagtgtcgccccaggcccaggcc
gaagccgagcaggcggtgctggacttcagtgccctgctgcgcgaactggtggctctgcgc
cgcacacgtccacaggacgacctgattaccgccctcgttcaggccgaggaaggcggcgac
cgcctgactgagcaggagctgatcgacacctgcattctgctgctgaacgctggtcatgag
gccagtgtcaatggcctgtcagcgggcgtgctggccctgctgcgccagccggagcactgg
caagccctggtagaggccgcaccacgcgaagacagcctgccgctgttccgccttgccatt
gaagagctgctgcgctatgacacgccgctgcccatgttcgagcgaatcgcgctggagaag
atgcagcttttcggcacggatctccggcccggtgaccgtgtggctctgctgtatgccagt
ggcaaccgtgacccccgccggtttgaacgtcccaacgagctggtcctgagccgtgacccc
aatccccatctgacctttggcctgggcattcactattgcctgggtgcccccctggcccgg
ctagagctggccctgagcctgcgggccctgtgccgcgccatgccggatctgcggctcaac
gacccggacggatcagcgcactacaccggtggctttgttatccgggggctggcgcggctg
gacgtacggagcgggtaa

DBGET integrated database retrieval system