KEGG   Deinococcus deserti: Deide_08400Help
Entry
Deide_08400       CDS       T00880                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ddr  Deinococcus deserti
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Deide_08400
Enzymes [BR:ddr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Deide_08400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1023320..1024222
Genome map
AA seq 300 aa AA seqDB search
MSLLVVGSINVDITVRAERIPAPGETVLGQDAQLSPGGKGANQAVAAALAGAAVQMVGAV
GQDAFQDVALAGLRRSGVDLGRVQLFNAPTGLALITVDPAAENAITVASGANALLGPAHL
PERLDAFTHLLLQQELGPEVTLAAARQGHADGLHVVLNAAPARGADLELLRHVHLLVVNE
HELAVLCGRDLKPEAAELETAARTLLVRGPDAVTVTLGAAGHLTVTANETLRFPAHPVTP
VDTTGAGDTFCGVLAARLDHGEGLRAALRAAGVAASLACTRSGAQDAMPDWAEIRALLDA
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gtgagtctgctggttgtggggagtatcaatgtagatatcactgtgcgggccgagcgcatt
ccggctcccggcgagaccgtactgggtcaggacgcccagctgtcccccggaggaaagggc
gccaatcaggctgtggcggcagcgctggccggtgctgctgtgcagatggtcggcgcagtc
ggccaggacgcctttcaggatgtggccctggctggtctcagacgcagcggggtggacctg
ggcagagtgcagcttttcaacgcgcctacaggtcttgctcttattacggttgatccagct
gcggagaatgccatcacagtggccagcggtgccaatgccctgctgggaccagcccacctg
cctgaacgactggacgcctttacgcatctgctgctgcaacaggagcttggaccggaggta
acgcttgcggcggcgcgccagggtcacgcagacggcctgcacgttgtgctgaacgcggcg
cctgcgcgaggtgcagacctggaactgctccgccatgtccaccttctggttgtcaacgaa
cacgaactggccgtgttatgcgggcgagacctgaaacctgaagccgccgaactggaaact
gcagcccggaccctgcttgtccgcggaccagatgccgtgacggtcacgctgggcgcggcg
ggtcacctgaccgtgacagccaatgaaacactgcgtttcccggcgcatccagtgaccccc
gtggacaccaccggtgcaggagacaccttctgcggggttctcgccgcccggctggatcac
ggtgaagggctgcgtgcggcgctgcgggcagccggggtagcagccagtctggcctgcacc
cgttcaggagcgcaggatgcgatgccggactgggcagagatccgggcgctgcttgacgcc
tga

DBGET integrated database retrieval system