KEGG   Deinococcus deserti: Deide_09210Help
Entry
Deide_09210       CDS       T00880                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ddr  Deinococcus deserti
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Deide_09210
Enzymes [BR:ddr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Deide_09210
Exosome [BR:ddr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Deide_09210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1120784..1122712
Genome map
AA seq 642 aa AA seqDB search
MSDSFLPLPLDYGHLQQMATSDLVRPDHLLGAHVATQGGVEGVRFAVWAPGAQHVSVVGD
FNDWNGFENAMTRLDFGVWGTFVPGARMGQRYKYRVTSAAGQTEDKMDPYGSAFELRPAT
ASVVWEDRFEWTDTRWMSSRTAGFDQPVSVYEVHVGSWMRRDDGWFLNYRELAHKLGEYV
TYMGFTHVELLGVMEHPFDGSWGYQVTGYYAPTSRLGTPEDFKYLVNHLHGLGIGVILDW
VPGHFPTDPSGLARFDGGPLYEYADPRRGFHQDWNTFIFDYGRNEVVMFLIGSALKWLQD
FHVDGLRVDAVASMLYLDFSRTEWVPNVHGGRENLEAVAFLKRLNEVTHHMCPGCMIIAE
ESTSFPGVTVPSPYGLGFDYKWAMGWMNDTLAYFEQDPLWRKHHHHKLTFYNVYRTSENY
VLAISHDEVVHLKKSLVMKMPGDWYTQRAQYRTFLALMWTMPGKKLLFMGQEFAQSTEWD
HDASLPWYLTDVPDHRGVMNLVRRLNQLYRERPDWYRGDKRDDSLYWVSADDADQSVYAY
VRRDSESGQWSLAVANLTPTYREQYRVGVPQAGEYRLLLSTDDGEYGGFGTQQPSLMASQ
EGWHGQPYSLSLNLPPSSVLILEFAGDVQTLTYRQPEESPQA
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgagcgattccttcctgcctctgccactggattacggtcatctgcagcaaatggcgacc
tccgatctggtaaggccggaccacctgctgggcgcacacgttgccacacaaggcggagta
gagggcgtacgcttcgctgtctgggcccccggtgcgcagcacgtcagcgtggtgggcgac
ttcaacgactggaacggatttgaaaatgctatgacccggctggacttcggagtctggggc
acctttgtgcctggagcccgcatgggccagcgttacaagtaccgcgtcacttccgctgcc
gggcagaccgaagacaagatggacccttacggcagcgcgtttgagctgcgcccggccacg
gccagtgtcgtctgggaggaccggttcgagtggacggacacacgctggatgtcctcgcgc
acagctggcttcgaccagccggtcagcgtctacgaggtgcatgtcggttcatggatgcgg
cgtgacgacggctggttcctgaactaccgcgaactggcccacaaactgggcgagtacgtc
acgtacatgggctttacgcatgtggaattgctgggtgtcatggagcaccccttcgatggc
tcgtgggggtatcaggtgactgggtactacgcccccaccagccgcctgggcacccccgag
gatttcaagtatctggtcaaccacctgcatggactgggtatcggcgtgattctggactgg
gttcccggtcacttcccgacggatccgtccggactggcccgctttgacgggggaccgctg
tacgagtacgccgatccacgccgcgggttccaccaggactggaacacgttcatcttcgac
tatggccgcaacgaggtcgtgatgttcctgatcggctcggccctcaagtggctgcaagac
ttccacgtcgacggcctgcgggtggacgcggtcgccagcatgctgtacctggatttttca
cgcaccgagtgggtgcccaacgtccacggtgggcgcgagaacctggaggccgttgcattt
ctcaagcgcctgaatgaagtgacccaccacatgtgcccggggtgcatgatcatcgccgag
gaaagcacgtcctttcctggcgtgaccgtgccgtcgccgtacgggctggggtttgactac
aagtgggccatgggctggatgaacgatacactggcgtacttcgagcaggatccgctgtgg
cgcaagcaccaccaccacaagctgacgttctacaacgtgtaccgcaccagtgagaactac
gtgctggccatcagccacgacgaggtggtgcacctcaagaagtcgctggtcatgaagatg
ccgggtgactggtacacccagcgcgcccagtaccggacatttctggccctgatgtggacc
atgccaggcaagaaactgctgtttatggggcaggaattcgcgcagtccacagagtgggac
catgacgcctccctgccctggtacctcaccgatgtcccggaccaccgcggcgtgatgaat
ctggtgcggcgcctcaaccagctctaccgtgagcggcctgactggtaccggggcgacaaa
cgtgacgacagcctgtactgggtcagcgcggacgacgccgatcagagcgtgtacgcctac
gtgcggcgggacagcgaatcgggtcagtggagtctggccgtagccaacctgacgccgacc
taccgcgagcagtaccgggttggcgtgccacaggccggagagtaccgtctgctgctttcc
acggacgacggcgaatacggcggtttcggaacccagcagccgtccctgatggcaagccag
gaaggctggcatggccagccctactcgctgagcctcaatctgcctccaagcagcgtcctg
attctcgaattcgcaggggacgtgcaaacgctcacataccggcagcctgaggagagtcct
caagcgtga

DBGET integrated database retrieval system