KEGG   Deinococcus deserti: Deide_10280Help
Entry
Deide_10280       CDS       T00880                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ddr  Deinococcus deserti
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Deide_10280
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Deide_10280
Enzymes [BR:ddr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Deide_10280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1239735..1241165
Genome map
AA seq 476 aa AA seqDB search
MVDIPGPTLDPDTADFLRRYGVRSVCLFGKNVRNEFQLRALCRDLRDLMGDGALIALDHE
GGAILRPDFWPFAPSAMALGAADDRQLTRDVNAALARQLRSVGINWNFAPVLDVNLNPGN
PVIGERAYGADPALVARHGRAALEGHAAERIAACVKHFPGHGDTHLDSHLALPTVRKTRV
ELEQGELAPFRALLGVSPAVMTAHIVYPELDPRHPATLSRVVLHDLLRRDWGYQGVIVTD
SMGMQAIDANYGRGEAAVLALQAGADLVMALGRREVQEATLQAIAAAMKTVLDGGEMQAS
LNRLRSLALQYPAQADETLNPAADAGFFGEAWAQGLTTWGEPVPPAPDSRVVLIAHRSPE
RETVSEAAADAETLARELGAVYEVELVPFQTPDELDWTALRARGLPLILATTGRHRHAAL
QGARPDLHLALYNPYAILDVDAPAVVSYGFRPEARASVLRWLRGELPAAGRLPFQA
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggtagatattcccgggcccaccctggaccctgacacagctgattttctgcgccggtat
ggggtacggagcgtctgcctgttcggcaagaatgtgcgcaacgagttccagttacgggcc
ttgtgccgtgacctgagagacctgatgggcgacggcgccctgattgccctggaccatgag
ggaggcgccattcttcgcccggatttctggccgtttgcgccctcggccatggcgctggga
gccgcagacgaccggcagctgacccgggacgtcaacgccgcgctggcacggcagctgcgc
agtgtcggaatcaactggaatttcgcgccggtactggatgtcaatctcaaccctgggaat
ccggtaatcggggagagggcctacggtgcggacccggcgctggtggcccgacatggccgc
gctgccctggagggacacgccgccgagcgcattgcggcgtgtgtcaagcactttccgggt
cacggcgatactcatctggacagccatctggccctgcccaccgtacgcaagacccgcgtg
gaactcgaacagggcgaactagctcccttcagggccctgctcggcgtgtcgccagctgtc
atgactgcgcacatcgtgtatccggaactcgatccccggcaccccgccaccctgagccgc
gtggtgctgcatgatctgctgcgccgcgactggggataccagggcgtcatcgtgacagac
agcatgggcatgcaggccatcgacgccaactatggccgtggtgaggcggcggtgctggcg
cttcaggctggtgccgatctggtgatggcactgggacgccgtgaggtgcaggaggcgacg
ttgcaggctatcgcggccgctatgaaaaccgttcttgacggcggtgagatgcaggccagc
ctgaaccgtctgcgttccctcgcacttcagtatccggctcaggccgatgaaacattgaat
cctgcggctgatgcgggcttttttggagaagcctgggcgcaggggttgacgacctggggc
gagcctgtgccgccagccccagactcacgggttgtgctgattgcccaccggagtccggag
cgggaaacggtcagcgaggccgcagcggacgccgagaccctggcacgcgaactgggagcg
gtgtatgaggtggagcttgttccattccagacgcccgatgagctggactggaccgccctg
agagcgcggggccttcccttgattctggccacgacaggacgtcaccgccacgctgcgctg
caaggtgcccggccggacctccacctggccctctataacccctacgccatcctggacgtg
gatgcgccggctgtcgtgtcgtacggtttccgtccagaggcacgcgcttctgtgctcagg
tggctccgcggagagttgccggcagccggtcgtctcccttttcaggcatga

DBGET integrated database retrieval system