KEGG   Deinococcus deserti: Deide_10280Help
Entry
Deide_10280       CDS       T00880                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ddr  Deinococcus deserti
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ddr00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:ddr00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1239735..1241165
Genome map
AA seq 476 aa AA seqDB search
MVDIPGPTLDPDTADFLRRYGVRSVCLFGKNVRNEFQLRALCRDLRDLMGDGALIALDHE
GGAILRPDFWPFAPSAMALGAADDRQLTRDVNAALARQLRSVGINWNFAPVLDVNLNPGN
PVIGERAYGADPALVARHGRAALEGHAAERIAACVKHFPGHGDTHLDSHLALPTVRKTRV
ELEQGELAPFRALLGVSPAVMTAHIVYPELDPRHPATLSRVVLHDLLRRDWGYQGVIVTD
SMGMQAIDANYGRGEAAVLALQAGADLVMALGRREVQEATLQAIAAAMKTVLDGGEMQAS
LNRLRSLALQYPAQADETLNPAADAGFFGEAWAQGLTTWGEPVPPAPDSRVVLIAHRSPE
RETVSEAAADAETLARELGAVYEVELVPFQTPDELDWTALRARGLPLILATTGRHRHAAL
QGARPDLHLALYNPYAILDVDAPAVVSYGFRPEARASVLRWLRGELPAAGRLPFQA
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggtagatattcccgggcccaccctggaccctgacacagctgattttctgcgccggtat
ggggtacggagcgtctgcctgttcggcaagaatgtgcgcaacgagttccagttacgggcc
ttgtgccgtgacctgagagacctgatgggcgacggcgccctgattgccctggaccatgag
ggaggcgccattcttcgcccggatttctggccgtttgcgccctcggccatggcgctggga
gccgcagacgaccggcagctgacccgggacgtcaacgccgcgctggcacggcagctgcgc
agtgtcggaatcaactggaatttcgcgccggtactggatgtcaatctcaaccctgggaat
ccggtaatcggggagagggcctacggtgcggacccggcgctggtggcccgacatggccgc
gctgccctggagggacacgccgccgagcgcattgcggcgtgtgtcaagcactttccgggt
cacggcgatactcatctggacagccatctggccctgcccaccgtacgcaagacccgcgtg
gaactcgaacagggcgaactagctcccttcagggccctgctcggcgtgtcgccagctgtc
atgactgcgcacatcgtgtatccggaactcgatccccggcaccccgccaccctgagccgc
gtggtgctgcatgatctgctgcgccgcgactggggataccagggcgtcatcgtgacagac
agcatgggcatgcaggccatcgacgccaactatggccgtggtgaggcggcggtgctggcg
cttcaggctggtgccgatctggtgatggcactgggacgccgtgaggtgcaggaggcgacg
ttgcaggctatcgcggccgctatgaaaaccgttcttgacggcggtgagatgcaggccagc
ctgaaccgtctgcgttccctcgcacttcagtatccggctcaggccgatgaaacattgaat
cctgcggctgatgcgggcttttttggagaagcctgggcgcaggggttgacgacctggggc
gagcctgtgccgccagccccagactcacgggttgtgctgattgcccaccggagtccggag
cgggaaacggtcagcgaggccgcagcggacgccgagaccctggcacgcgaactgggagcg
gtgtatgaggtggagcttgttccattccagacgcccgatgagctggactggaccgccctg
agagcgcggggccttcccttgattctggccacgacaggacgtcaccgccacgctgcgctg
caaggtgcccggccggacctccacctggccctctataacccctacgccatcctggacgtg
gatgcgccggctgtcgtgtcgtacggtttccgtccagaggcacgcgcttctgtgctcagg
tggctccgcggagagttgccggcagccggtcgtctcccttttcaggcatga

DBGET integrated database retrieval system