KEGG   Deinococcus deserti: Deide_10500Help
Entry
Deide_10500       CDS       T00880                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ddr  Deinococcus deserti
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Deide_10500
Enzymes [BR:ddr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Deide_10500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1269526..1270458
Genome map
AA seq 310 aa AA seqDB search
MKFYVIGDVTVDHLYHLDRLPAPGEEVAPIRASMEPGGAGGTISVTLARLGHTVTLAARV
GADPFAEYALSHVRQTGVSESAIQRDPEVLTSTITVMQTASGQRAMISDGAANRLLDPAK
LKKKDVEGADALIVSAYSLTEGPQREYALKAIDLARGAKKPVPVFIDLGAGAVNRAGTSL
LGSVIQADYLMLNQHELLALTGTNSISAALAQLGSKGAQRVIVKVGKMGSIVWTPTETEL
VDAVTLAENLVDSTGAGDTFTGAFAHAVMTGASLAEAARAANAAGALSVTSFGAQERPIT
PADLAQVLKQ
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttttacgttatcggtgacgtcaccgtcgaccacctgtaccacctagatcgcctg
cctgctcccggcgaggaagtagccccgattcgtgccagcatggagcccggtggagctgga
gggaccatcagcgtgaccctcgcgcgcctgggccacaccgttaccctggctgcccgcgtg
ggcgccgacccctttgctgagtatgccctgagccatgtgcggcagaccggggtcagtgaa
agcgcgattcagcgtgatccggaagtgctgacgagcacgattaccgttatgcagacggcc
agtggccagcgcgccatgatcagcgacggcgccgccaaccggctgcttgatcctgcgaag
ctcaagaagaaggatgtcgaaggagccgacgctctgatcgtgagtgcctacagcctgact
gaaggcccacagcgtgaatacgccctcaaggctattgatctggcccggggtgccaagaag
ccggtgccggtgtttattgacctgggtgccggcgcggtcaaccgggcaggtaccagcctg
ctcggtagcgtgattcaggcggactacctgatgctcaaccagcacgagctcttggccctg
accggcaccaacagcatcagtgcggcgttggcccagctgggcagcaagggtgcccagcga
gtgatcgtcaaagtcggcaagatgggctcaatcgtatggacccccacggaaacggaactg
gtcgacgctgtgacccttgcggagaacctggtcgactccacgggagcgggtgacactttt
accggggcctttgcccacgcggtgatgaccggagcgtcactggccgaggctgcgcgtgcg
gccaatgctgcgggcgccctgtcggtgacaagctttggtgctcaggaacggcctattacc
ccggctgatctggcacaggtcctgaagcagtag

DBGET integrated database retrieval system