KEGG   Deinococcus deserti: Deide_11390Help
Entry
Deide_11390       CDS       T00880                                 

Definition
(GenBank) putative triose-phosphate isomerase (phosphotriose isomerase)
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ddr  Deinococcus deserti
Pathway
ddr00010  Glycolysis / Gluconeogenesis
ddr00051  Fructose and mannose metabolism
ddr00562  Inositol phosphate metabolism
ddr01100  Metabolic pathways
ddr01110  Biosynthesis of secondary metabolites
ddr01120  Microbial metabolism in diverse environments
ddr01130  Biosynthesis of antibiotics
ddr01200  Carbon metabolism
ddr01230  Biosynthesis of amino acids
Module
ddr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ddr_M00002  Glycolysis, core module involving three-carbon compounds
ddr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deide_11390
   00051 Fructose and mannose metabolism
    Deide_11390
   00562 Inositol phosphate metabolism
    Deide_11390
Enzymes [BR:ddr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Deide_11390
Exosome [BR:ddr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Deide_11390
  Exosomal proteins of bladder cancer cells
   Deide_11390
  Exosomal proteins of melanoma cells
   Deide_11390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACO46044
UniProt: C1CV27
Position
complement(1381510..1382244)
Genome map
AA seq 244 aa AA seqDB search
MPNNLLALNWKMNKTPSEAQAWAAELSSALSPGEAELAVMAPAIMLPALAAGLPAGVAYG
GQDVSQHESGAYTGEISAAMLRDVGAKYAIVGHSERREYHGETDAVVAAKARQAQAHGLT
PIVCVGEGLEVRERGEHVQYTLAQLRGSLEGVGTDVVIAYEPVWAIGTGKTATAEDAEEL
AEAIRGALTEQYGEAAGTLRILYGGSVKPDNIASICAKPNVNGALVGGASLKVADVVGMN
DALK
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgccgaacaatctattggccttgaactggaaaatgaacaagaccccctccgaggctcag
gcctgggcggccgagctgtcctccgcactgtcaccgggtgaagccgaactggccgtcatg
gccccggccatcatgcttccagcacttgccgccgggctgccggctggcgtggcttatggc
gggcaggatgtcagccagcatgaatcaggagcgtataccggcgagatcagcgccgccatg
ctcagggacgtaggggccaagtacgccatcgtgggccacagcgagcgccgtgagtaccac
ggtgaaaccgacgccgtggtggccgccaaggcacgtcaggcacaggctcacggattgact
cctatcgtctgcgtgggcgaagggctggaggtgcgtgaacgtggtgagcacgtccagtac
acgctcgcccagctgcgtggcagcctcgaaggagtcggaacggatgtggtgattgcctac
gagcccgtctgggcgatcgggaccggcaagaccgccacagcggaagacgctgaggagctc
gctgaagctatccgcggcgctctgaccgaacagtacggtgaggctgcgggcaccctgcgc
attctgtacggcggtagcgtcaagccggacaacatcgcttcaatctgcgccaagccgaat
gtgaacggcgctctggtcggcggcgccagcctcaaggttgctgacgttgtcggcatgaac
gacgctttgaagtaa

DBGET integrated database retrieval system