KEGG   Deinococcus deserti: Deide_11390Help
Entry
Deide_11390       CDS       T00880                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ddr  Deinococcus deserti
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deide_11390 (tpiA)
   01230 Biosynthesis of amino acids
    Deide_11390 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deide_11390 (tpiA)
   00051 Fructose and mannose metabolism
    Deide_11390 (tpiA)
   00562 Inositol phosphate metabolism
    Deide_11390 (tpiA)
Enzymes [BR:ddr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Deide_11390 (tpiA)
Exosome [BR:ddr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Deide_11390 (tpiA)
  Exosomal proteins of bladder cancer cells
   Deide_11390 (tpiA)
  Exosomal proteins of melanoma cells
   Deide_11390 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1381510..1382244)
Genome map
AA seq 244 aa AA seqDB search
MPNNLLALNWKMNKTPSEAQAWAAELSSALSPGEAELAVMAPAIMLPALAAGLPAGVAYG
GQDVSQHESGAYTGEISAAMLRDVGAKYAIVGHSERREYHGETDAVVAAKARQAQAHGLT
PIVCVGEGLEVRERGEHVQYTLAQLRGSLEGVGTDVVIAYEPVWAIGTGKTATAEDAEEL
AEAIRGALTEQYGEAAGTLRILYGGSVKPDNIASICAKPNVNGALVGGASLKVADVVGMN
DALK
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgccgaacaatctattggccttgaactggaaaatgaacaagaccccctccgaggctcag
gcctgggcggccgagctgtcctccgcactgtcaccgggtgaagccgaactggccgtcatg
gccccggccatcatgcttccagcacttgccgccgggctgccggctggcgtggcttatggc
gggcaggatgtcagccagcatgaatcaggagcgtataccggcgagatcagcgccgccatg
ctcagggacgtaggggccaagtacgccatcgtgggccacagcgagcgccgtgagtaccac
ggtgaaaccgacgccgtggtggccgccaaggcacgtcaggcacaggctcacggattgact
cctatcgtctgcgtgggcgaagggctggaggtgcgtgaacgtggtgagcacgtccagtac
acgctcgcccagctgcgtggcagcctcgaaggagtcggaacggatgtggtgattgcctac
gagcccgtctgggcgatcgggaccggcaagaccgccacagcggaagacgctgaggagctc
gctgaagctatccgcggcgctctgaccgaacagtacggtgaggctgcgggcaccctgcgc
attctgtacggcggtagcgtcaagccggacaacatcgcttcaatctgcgccaagccgaat
gtgaacggcgctctggtcggcggcgccagcctcaaggttgctgacgttgtcggcatgaac
gacgctttgaagtaa

DBGET integrated database retrieval system