KEGG   Deinococcus deserti: Deide_11710Help
Entry
Deide_11710       CDS       T00880                                 

Definition
(GenBank) putative succinate--CoA ligase (succinyl-CoA synthetase) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ddr  Deinococcus deserti
Pathway
ddr00020  Citrate cycle (TCA cycle)
ddr00640  Propanoate metabolism
ddr00660  C5-Branched dibasic acid metabolism
ddr01100  Metabolic pathways
ddr01110  Biosynthesis of secondary metabolites
ddr01120  Microbial metabolism in diverse environments
ddr01130  Biosynthesis of antibiotics
ddr01200  Carbon metabolism
Module
ddr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ddr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Deide_11710
   00640 Propanoate metabolism
    Deide_11710
   00660 C5-Branched dibasic acid metabolism
    Deide_11710
Enzymes [BR:ddr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Deide_11710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ACO46077
UniProt: C1CV60
Position
complement(1418775..1419932)
Genome map
AA seq 385 aa AA seqDB search
MKLHEYQGKEILRQFGVNVQDGKVARTPDEVRQIAREYGQPVVVKAQVHVGGRGKAGGVK
FSPTEDKAFENGEKILGMDIKGLTVNKVLVTKAVDIDAGTEYYVGMIVDRNVQSFTLMAS
AEGGMEIEEVAAATPEKIIKHRVDPVTGLRPYEAREVAIRAGFKGNLNKIADMMVKMSEA
ALKRDAVLVEINPLFVGPDGVPLALDTKFEIDDNAMYRHQDLADWRELEAEHPLEIEASK
YGFAYVKLDGNVGVLGNGAGIVMTSLDVVNRAGAKPANFLDIGGGAKAEVVYNAVKLVSK
DSDVKAIFINIFGGITRADEVAKGVIQALKDGILTKPVRMRIAGTAEDEAKALLAEVNSP
LIQMYPTMFEAADEAAKEANAAEAK
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacttcacgagtatcagggcaaggaaattctgcgccagttcggcgtcaacgttcag
gacggcaaggtcgcccgcacccccgacgaggtgcgtcagatcgcccgcgagtacggtcag
ccggtggtcgtcaaggcccaggtgcacgtgggcggccgcggtaaggccggtggcgtgaag
ttcagccccaccgaggacaaggccttcgagaacggcgaaaagattctgggcatggacatc
aagggtctgaccgtcaacaaggtgcttgttaccaaggccgtggacatcgacgcaggtacc
gagtactacgtcggtatgatcgttgaccgcaacgtgcagagcttcaccctgatggcctcc
gccgagggtggcatggaaatcgaggaagttgccgccgcaactcccgagaagatcatcaag
caccgcgtggacccggtgaccggcctgcgcccctacgaggcgcgcgaggtggccatcagg
gccggcttcaagggcaacctgaacaaaattgccgacatgatggtcaagatgagtgaggcc
gcgctgaagcgtgacgccgtgctggtcgagatcaacccactgttcgtgggccctgacggc
gtaccgctggccttggacaccaagttcgagatcgacgacaacgccatgtaccgtcaccag
gacctggctgactggcgcgaactggaagccgagcaccccctggaaatcgaggccagcaag
tacggcttcgcctacgtgaagcttgatggcaacgtcggcgtactggggaacggcgcaggc
atcgtgatgacctcgctggacgtggtcaaccgcgctggcgccaagccggccaacttcctg
gacattggcggcggcgccaaagccgaagtcgtgtataacgccgtgaagctggtcagcaag
gacagtgatgtcaaggccatctttatcaacatcttcggcggcatcacccgcgccgacgag
gttgccaaaggcgttatccaggccctgaaagacgggatcctgaccaagcctgtgcgcatg
cgcatcgccggcacggccgaggacgaagccaaggcgctgctggctgaagtcaacagcccc
ctgatccagatgtaccccaccatgtttgaagcggccgatgaagctgccaaggaagcaaac
gctgcggaggccaaataa

DBGET integrated database retrieval system