KEGG   Deinococcus deserti: Deide_11750Help
Entry
Deide_11750       CDS       T00880                                 

Definition
(GenBank) putative tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ddr  Deinococcus deserti
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Deide_11750
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Deide_11750
Enzymes [BR:ddr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Deide_11750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1424761..1425561)
Genome map
AA seq 266 aa AA seqDB search
MTATIARGVERLHRAFARADAEGRAAFIPFMTAGYPSAEAFPALADQLIEQADIMEIGIP
YSDPLGDGPTIQRASEKALAGGTSTRGTLELIRELRRRHDTPIVVMTYVNPIYAVGPEKF
MALAAEAGVDGLILPDLPPDQDLEIADLAAKFGLAVTFLIAPTSTPARVELVAQACTGFL
YAVSVTGVTGTREGTALGEVPAMLDLARKHATVPIVVGFGVKDAATAHQVAQMADGVVVG
SAFINAARDGADVSALAREIAAGCQR
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgacagctaccattgcccgtggggtagagcgcttacaccgcgcctttgcccgtgccgat
gccgagggccgcgctgccttcatcccgtttatgaccgccggctatcccagcgcggaggcc
tttcccgccctggctgaccagctgatcgaacaggccgacatcatggaaatcggcattcca
tacagcgatccactgggcgatggccccaccattcagcgcgcctcggaaaaggcactggct
ggcggaaccagcaccagaggaaccctggagctgatccgtgaactgcgccgccgccacgac
acgccgatcgtggtgatgacgtatgtcaatcccatctatgccgtcggcccggaaaaattc
atggccctggctgcggaggcaggtgtagacggtctgattctgccggacctgccgcccgat
caggatctggaaatcgcggaccttgctgccaaatttggtctggcggtgaccttcctgatc
gccccgacctcgactcccgcccgggtggaactggtggcgcaggcctgtaccggctttctg
tatgccgtcagcgtcaccggcgtcaccgggacccgcgaaggcactgccctgggcgaagtg
ccggccatgcttgatctggcgcgcaagcatgcgacggtgccgattgtggtgggcttcggc
gtgaaggacgctgctacggctcatcaggtggcgcagatggccgacggcgtggtggtgggc
agcgcctttatcaatgctgctcgtgacggggcagacgtctctgctctggcccgcgagatc
gcagccggctgccagcgctga

DBGET integrated database retrieval system