KEGG   Deinococcus deserti: Deide_11760Help
Entry
Deide_11760       CDS       T00880                                 

Definition
(GenBank) putative tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ddr  Deinococcus deserti
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Deide_11760
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Deide_11760
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Deide_11760
Enzymes [BR:ddr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Deide_11760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1425558..1426820)
Genome map
AA seq 420 aa AA seqDB search
MPLVFPSFPLPDVRGRFGRYGGRYVPETLIPALDELDAAYQVAKQDPIFLTELDRLYREF
VGRPSGLYFARRLTEHAGGAKIYLKREDQNYTGAHKINNCLAQALLAVRMGKRRVIAETG
AGQHGVASATAAALLGLECVVYMGEEDIRRQALNVFRMKLLGAEVRPVTSGTGTLKDATN
EAIRDWVTHVRDTFYILGSVVGPHPYPAMVRDFQSIIGEEVMLQLPALEGRSIPDAVVAC
VGGGSNAIGIFAPFAYLPADQRPRLIGTEAAGEGVHTGKHAASVAGGRVGVLHGSLMYLM
NDDEGQIVPPHSISAGLDYPGIGPEHCYYSDAGLAEYVPVTDAQALEALQMLTRLEGIIP
ALESSHAVYHAVELARTMSPDQVIVVNLSGRGDKDVAEVMRLLDLSREQANTDMTREVTA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgcccctggtattcccgtcttttccgctgccggatgtgcgcggccgtttcggccgttac
ggcgggcgttatgttccagaaaccctgattcccgccctggatgaacttgatgctgcgtat
caggtggccaagcaggatcccatcttcctgacagaacttgaccggctctaccgcgaattc
gtgggtcgtcccagtgggctgtatttcgcccgtcggctgaccgagcatgctggcggcgcc
aaaatctacctcaagcgcgaggaccagaactacaccggcgcgcataagatcaacaactgc
ctggcccaggcgctgctggctgtgcggatgggcaagcggcgggtcatcgccgagaccggc
gccggacagcacggggttgccagcgcgacggcggctgcactcctgggcctggaatgcgtg
gtctacatgggcgaggaggacatccgtcgtcaggccctcaacgtcttccggatgaagctg
ctgggggctgaagtccggcctgtcaccagcggcaccggaaccctcaaggacgccaccaac
gaggcaatccgcgactgggtcacacacgttcgcgacaccttctacattctgggcagcgtc
gtgggaccccacccgtacccggccatggtcagagacttccagagcatcatcggtgaggaa
gtcatgctgcagctgccggcgctggaaggccgctccattcccgacgccgtggtggcctgc
gtgggcggcggcagcaatgccatcgggatctttgctccgttcgcctacctgccggctgat
cagcgcccgcgtctgatcggcaccgaggccgccggggaaggggttcataccggcaaacat
gccgcgtcggttgctggcggccgggtgggcgtgctgcacggctcgctgatgtacctgatg
aacgacgatgagggccagattgtgccgccgcactccatcagcgccggtctggactaccct
ggcattggcccggagcactgctactacagcgacgccgggctggcggagtatgtcccggtc
accgatgcgcaggccctcgaagccctgcagatgctgacccgtctggaaggaatcattcct
gcgctggaaagctcacatgccgtttaccacgcggtcgaacttgcgcggaccatgagtccc
gaccaggtgattgtggtcaacctcagtggacgcggtgacaaggatgtggccgaagtcatg
cgccttctggacctgagcagggaacaagccaacacagacatgacccgggaggtcactgca
tga

DBGET integrated database retrieval system