KEGG   Deinococcus deserti: Deide_11990Help
Entry
Deide_11990       CDS       T00880                                 

Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
ddr  Deinococcus deserti
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deide_11990
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Deide_11990
   00630 Glyoxylate and dicarboxylate metabolism
    Deide_11990
Enzymes [BR:ddr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Deide_11990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1453499..1455076)
Genome map
AA seq 525 aa AA seqDB search
MTQTTLTRIQYQPHPDAGRVLTAGALAFLDELHTRFDARRRELLKARQERQQQLDAGELP
DFLPDTAHIRAADWKIAPLPADLLDRRVEITGPVDRKMVINALNSGARVFMADFEDANSP
TWANCIEGQVNLMDAVRRTIALEQGGKSYRLNDTTATLLVRPRGLHLEEKHATLGGEVLS
GSLFDFGLYAYHNAQERTTQGTGLYFYIPKLESHLEARWWNDVFTFTEETLGLTRGTIRA
TVLIETILAAFEMDEILYELREHSAGLNCGRWDYIFSFIKKFRSRHDKILPDRAVVTMAT
PMMQNYSKLAIQTCHRRGAPAIGGMSAFIPVKNDEAANERAFAQVQADKEREATNGHDGT
WVAHPGMVALATEVFDRLMPGPNQIDSGKQADLKITAADLLTPPEGHITEGGVNTNVDVS
IQYIAAWLEGRGAVPIHNLMEDAATAEISRAQLWQWAHHEQRTDEGTPITPEGLTRLIDA
HAARLKAEQPGREDRISEAATLLKRLVTQEQFEDFLTLPGYQHLA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagacgaccctcacccgcatacagtaccagccgcaccccgacgcgggccgcgtg
ctgaccgcaggtgccctggcattcctggacgaactccatacccgttttgatgcccgtcgc
cgtgaactgctcaaagcccgtcaggagcgccagcaacagctcgacgccggcgagcttcct
gacttcctgccggacaccgcccacatccgggctgctgactggaagatcgcgccgttgccc
gctgacctgcttgaccgccgcgttgagatcaccggtccggtggaccgcaagatggtaatc
aacgccctgaacagcggggcccgcgtgttcatggccgacttcgaggacgccaacagcccc
acctgggccaactgcatcgagggtcaggtcaacctgatggacgcagtgcgccggaccatt
gctctggaacagggcggcaaaagctaccgtctgaatgacacgacggccaccctgctggtt
cgcccccgcggccttcacctggaagaaaagcacgccaccctgggcggtgaagttctgtca
ggaagcctgttcgactttgggctgtacgcctaccacaacgcgcaggagcgcaccacccag
ggaacggggctgtacttctacattcccaagctggaatcccacctcgaagcgcgctggtgg
aacgacgttttcacctttacggaagagaccctcggcctgacgcgaggcaccatccgcgcc
accgtgctgatcgaaaccatcctggctgccttcgagatggacgagattctctacgagctg
cgcgagcacagtgcgggtctgaactgcgggcgctgggattacatcttcagcttcatcaag
aagttccgcagccggcacgacaagatcctgccagaccgcgccgtggtcaccatggccacg
cccatgatgcagaactacagcaagctggccatccagacctgtcaccggcgcggcgccccg
gcaatcggcggcatgagcgcttttatcccggtcaagaacgacgaagcggccaacgaacgt
gccttcgcacaggttcaggccgataaggaacgcgaagccaccaacggccacgacggcacc
tgggtcgcccaccccggcatggtcgcgctggctaccgaagtcttcgaccgcctgatgccc
ggacccaaccagatcgacagcggcaagcaggcagacctgaagatcacagctgctgacctg
ctgacccctcctgaagggcacattacagaaggcggcgtcaacaccaacgtggacgtcagc
atccagtacatcgccgcctggctcgaaggacgcggcgcggtgcccatccacaacctgatg
gaagacgctgctaccgccgagatcagccgcgcgcagctgtggcagtgggcacatcacgaa
cagcgcaccgacgaaggcacgcccatcacccctgaaggcctgacccgcctgatcgacgcc
cacgccgcgcgcctgaaggctgaacagcccggccgtgaggaccgcatttccgaagctgcc
actctcctcaagcgcctggtgacccaggagcaattcgaggacttcctgaccctgcccggc
taccagcacctggcctga

DBGET integrated database retrieval system