KEGG   Deinococcus deserti: Deide_12440Help
Entry
Deide_12440       CDS       T00880                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein SdhD
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
ddr  Deinococcus deserti
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deide_12440
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Deide_12440
   00650 Butanoate metabolism
    Deide_12440
  Energy metabolism
   00190 Oxidative phosphorylation
    Deide_12440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1513133..1513510
Genome map
AA seq 125 aa AA seqDB search
MIRARTFTDARQQSHNNAELNWWIFMRISGLILVFLVLGHIYMTFIQVSESDATFDAVVA
KLSNPAWKFYDWMILFLSLLHGANGARYSIEDYIRSRPNRAWVKSIFYTVIALVFAFGTI
GLISI
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcgcgcggaccttcaccgatgcccggcagcaatcgcacaacaatgctgagctg
aactggtggatcttcatgcgtatcagcgggttgatcctggttttcctggtgctcgggcac
atctacatgacctttattcaggtcagtgaatccgatgccaccttcgacgcggtggtcgcc
aagctcagcaaccctgcctggaagttctacgactggatgattctgtttctgtccctgctg
cacggtgcgaacggagcacggtattcgattgaggactacatccgttcgcggcccaaccgg
gcctgggtcaagagcattttctacacggtgatcgcgctggtatttgcctttggcacgatc
ggcctgatctccatttga

DBGET integrated database retrieval system