KEGG   Deinococcus deserti: Deide_14610Help
Entry
Deide_14610       CDS       T00880                                 

Gene name
pfkA
Definition
(GenBank) putative 6-phosphofructokinase (Phosphofructokinase I) (Phosphohexokinase)
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ddr  Deinococcus deserti
Pathway
ddr00010  Glycolysis / Gluconeogenesis
ddr00030  Pentose phosphate pathway
ddr00051  Fructose and mannose metabolism
ddr00052  Galactose metabolism
ddr00680  Methane metabolism
ddr01100  Metabolic pathways
ddr01110  Biosynthesis of secondary metabolites
ddr01120  Microbial metabolism in diverse environments
ddr01130  Biosynthesis of antibiotics
ddr01200  Carbon metabolism
ddr01230  Biosynthesis of amino acids
ddr03018  RNA degradation
Module
ddr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deide_14610 (pfkA)
   00030 Pentose phosphate pathway
    Deide_14610 (pfkA)
   00051 Fructose and mannose metabolism
    Deide_14610 (pfkA)
   00052 Galactose metabolism
    Deide_14610 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    Deide_14610 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Deide_14610 (pfkA)
Enzymes [BR:ddr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Deide_14610 (pfkA)
Protein phosphatases and associated proteins [BR:ddr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Deide_14610 (pfkA)
Messenger RNA biogenesis [BR:ddr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Deide_14610 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: ACO46414
UniProt: C1CW47
Position
complement(1783221..1784258)
Genome map
AA seq 345 aa AA seqDB search
MTDHPTSPNPTAVPATTARPNPAGVRRLAVLTSGGDAPGMNAAIRAVVRTGTQQGIEMIG
VRRGFSGLHRGELVVMGARDVANIIQRGGTILLTARSRTWRTPEGRARGAQVLRDWGVDG
LIVIGGDGSFHGGHYLQEEHGIPVIGIPGTIDNDLYGTDHTIGYFTAVETALDAVDKLRD
TGASHERIFVIEVMGRHAGHIALDVAVAGGAEEVFIPEDHKPVAGVVEIVKDSVAKGKRG
SIIIVAEGYEGGAQGVADAIEAGTGLETRVSILGHIQRGGSPVSSDRILASRLGEAAVYA
LMEGRKGVMVGRGASGVIYTPLHETWEKRKDVSRDLYRCAMTLSI
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgacagatcatccgacatcccccaaccctacagctgttcctgcgacgaccgcccgccca
aaccctgccggagtacgccggcttgctgtactgacgagcggcggcgacgctcccggcatg
aatgccgctattcgcgccgtggtgcgtaccggtacccagcagggcatcgagatgatcggc
gttcgccgcggattttccggtctgcaccgcggtgaacttgtggtgatgggagcgcgcgac
gtggccaacatcattcagcgtggcggcaccattctgctgacggcgcgcagccggacctgg
cgcacgccggagggccgtgcccgcggggcccaggtgctgcgggactggggcgtggacggg
ctgatcgtgattggtggcgacggcagctttcacggcggccactacctgcaggaagagcac
ggtattccggtcatcggcataccaggaaccatcgataacgacctttacgggaccgaccac
accatcggctatttcacagctgtggaaacggcgctggacgccgtggacaaactgcgcgat
accggagcctctcatgagcggatttttgtgatcgaagtcatgggccggcacgccgggcat
attgcgctggatgtcgccgtggccgggggcgccgaagaggtgtttattcctgaggaccac
aagccggtcgcgggtgttgtagagatcgtcaaagacagcgtagccaagggaaaacgcggc
agcatcatcatcgtggccgaagggtacgagggcggcgcgcagggcgtggcggacgccatc
gaggccggtaccggcctggaaacccgggtcagcatcctgggacatatccagcgaggcgga
tcaccggtatcgagtgaccgtattctggccagccggctgggtgaggccgccgtctatgcc
ctgatggaaggccgcaaaggcgtcatggtgggccgtggggccagcggcgtgatctacacg
cccctgcatgagacctgggaaaagcgcaaggacgtgagccgcgacctgtaccgctgcgcc
atgaccctcagcatctag

DBGET integrated database retrieval system