KEGG   Deinococcus deserti: Deide_14610Help
Entry
Deide_14610       CDS       T00880                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ddr  Deinococcus deserti
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:ddr01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ddr01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ddr00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ddr00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ddr00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ddr00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:ddr00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1783221..1784258)
Genome map
AA seq 345 aa AA seqDB search
MTDHPTSPNPTAVPATTARPNPAGVRRLAVLTSGGDAPGMNAAIRAVVRTGTQQGIEMIG
VRRGFSGLHRGELVVMGARDVANIIQRGGTILLTARSRTWRTPEGRARGAQVLRDWGVDG
LIVIGGDGSFHGGHYLQEEHGIPVIGIPGTIDNDLYGTDHTIGYFTAVETALDAVDKLRD
TGASHERIFVIEVMGRHAGHIALDVAVAGGAEEVFIPEDHKPVAGVVEIVKDSVAKGKRG
SIIIVAEGYEGGAQGVADAIEAGTGLETRVSILGHIQRGGSPVSSDRILASRLGEAAVYA
LMEGRKGVMVGRGASGVIYTPLHETWEKRKDVSRDLYRCAMTLSI
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgacagatcatccgacatcccccaaccctacagctgttcctgcgacgaccgcccgccca
aaccctgccggagtacgccggcttgctgtactgacgagcggcggcgacgctcccggcatg
aatgccgctattcgcgccgtggtgcgtaccggtacccagcagggcatcgagatgatcggc
gttcgccgcggattttccggtctgcaccgcggtgaacttgtggtgatgggagcgcgcgac
gtggccaacatcattcagcgtggcggcaccattctgctgacggcgcgcagccggacctgg
cgcacgccggagggccgtgcccgcggggcccaggtgctgcgggactggggcgtggacggg
ctgatcgtgattggtggcgacggcagctttcacggcggccactacctgcaggaagagcac
ggtattccggtcatcggcataccaggaaccatcgataacgacctttacgggaccgaccac
accatcggctatttcacagctgtggaaacggcgctggacgccgtggacaaactgcgcgat
accggagcctctcatgagcggatttttgtgatcgaagtcatgggccggcacgccgggcat
attgcgctggatgtcgccgtggccgggggcgccgaagaggtgtttattcctgaggaccac
aagccggtcgcgggtgttgtagagatcgtcaaagacagcgtagccaagggaaaacgcggc
agcatcatcatcgtggccgaagggtacgagggcggcgcgcagggcgtggcggacgccatc
gaggccggtaccggcctggaaacccgggtcagcatcctgggacatatccagcgaggcgga
tcaccggtatcgagtgaccgtattctggccagccggctgggtgaggccgccgtctatgcc
ctgatggaaggccgcaaaggcgtcatggtgggccgtggggccagcggcgtgatctacacg
cccctgcatgagacctgggaaaagcgcaaggacgtgagccgcgacctgtaccgctgcgcc
atgaccctcagcatctag

DBGET integrated database retrieval system