KEGG   Deinococcus deserti: Deide_14910Help
Entry
Deide_14910       CDS       T00880                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
ddr  Deinococcus deserti
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Deide_14910
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Deide_14910
Enzymes [BR:ddr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Deide_14910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1815295..1816077
Genome map
AA seq 260 aa AA seqDB search
MTSEGTTSHEGRAALVTGGTSGIGLAIAQRFQQDGMRVAVLDLDRPQSREVAETHGLIFI
AADLTRREDCRAAITKAVQVLGGLDVLVNNAGFQHIDPVADFPEDTWDAMIHVMLTAPFL
LSKYAWPYLTRSGQGRIINVASIHGHVASPFKSAYISAKHGVIGFTRTAALEAGEQGLTV
NAICPGYVRTPLVEGQIADQARTRGISAEEVEQKVMLEPAAIKRLLDPADVAALASYVAS
PAAWGMTGAVLDLDLGWTAR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacatctgagggcacgacatcacacgagggaagagctgctctggtaaccggcggcacc
agtggcatcggactggccattgcacagcggtttcagcaggacggcatgcgagtggcggtg
ctggacctcgaccgtccacagtcccgagaagtggctgaaacacacggacttatctttatt
gccgctgaccttacccggcgtgaggactgccgggcagccataacaaaggctgttcaagtc
ctgggcggcctggatgtgctggtcaacaatgccggcttccagcacattgacccggtggcc
gactttcccgaggacacctgggacgccatgattcacgtgatgctgacggcgccgtttctg
ctttccaagtatgcatggccctacctgacccgcagcgggcagggacgaatcatcaatgtg
gccagcattcacgggcacgtggccagtcccttcaagagtgcctatatcagtgccaagcac
ggcgtcattggtttcacacgaaccgcagccctggaagcgggcgaacagggcctgaccgtc
aacgccatctgcccaggctacgtgcgcacaccactggtagaggggcagatcgccgatcag
gcccgcacccgcggcatcagtgctgaggaagtggagcagaaggtcatgctggagcccgcc
gcaatcaagcgcctgcttgaccctgctgacgtggctgcactggcaagctacgtcgccagt
ccagcagcctggggcatgactggagcggtgctggacctggacctgggctggaccgcccga
tag

DBGET integrated database retrieval system