KEGG   Deinococcus deserti: Deide_14910Help
Entry
Deide_14910       CDS       T00880                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
ddr  Deinococcus deserti
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ddr00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:ddr00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1815295..1816077
Genome map
AA seq 260 aa AA seqDB search
MTSEGTTSHEGRAALVTGGTSGIGLAIAQRFQQDGMRVAVLDLDRPQSREVAETHGLIFI
AADLTRREDCRAAITKAVQVLGGLDVLVNNAGFQHIDPVADFPEDTWDAMIHVMLTAPFL
LSKYAWPYLTRSGQGRIINVASIHGHVASPFKSAYISAKHGVIGFTRTAALEAGEQGLTV
NAICPGYVRTPLVEGQIADQARTRGISAEEVEQKVMLEPAAIKRLLDPADVAALASYVAS
PAAWGMTGAVLDLDLGWTAR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacatctgagggcacgacatcacacgagggaagagctgctctggtaaccggcggcacc
agtggcatcggactggccattgcacagcggtttcagcaggacggcatgcgagtggcggtg
ctggacctcgaccgtccacagtcccgagaagtggctgaaacacacggacttatctttatt
gccgctgaccttacccggcgtgaggactgccgggcagccataacaaaggctgttcaagtc
ctgggcggcctggatgtgctggtcaacaatgccggcttccagcacattgacccggtggcc
gactttcccgaggacacctgggacgccatgattcacgtgatgctgacggcgccgtttctg
ctttccaagtatgcatggccctacctgacccgcagcgggcagggacgaatcatcaatgtg
gccagcattcacgggcacgtggccagtcccttcaagagtgcctatatcagtgccaagcac
ggcgtcattggtttcacacgaaccgcagccctggaagcgggcgaacagggcctgaccgtc
aacgccatctgcccaggctacgtgcgcacaccactggtagaggggcagatcgccgatcag
gcccgcacccgcggcatcagtgctgaggaagtggagcagaaggtcatgctggagcccgcc
gcaatcaagcgcctgcttgaccctgctgacgtggctgcactggcaagctacgtcgccagt
ccagcagcctggggcatgactggagcggtgctggacctggacctgggctggaccgcccga
tag

DBGET integrated database retrieval system