KEGG   Deinococcus deserti: Deide_16210Help
Entry
Deide_16210       CDS       T00880                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ddr  Deinococcus deserti
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Deide_16210
Enzymes [BR:ddr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Deide_16210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1978174..1980306
Genome map
AA seq 710 aa AA seqDB search
MSHALPNEPFRVTGGVNKVRFRAESGFTVMTARLRNNDGEDPDATVIGMMPPLDAGDSFS
ADVLMEEHREYGYQYRVLNLVLEATPADLTEAGVAAYLEARVGGVGKVLAGRIAKAFGPA
TFDLLETEPDKLLQVPGVTASTLHKMVQSWSQQGLERRLLAGLQGLGLTISQAQRAVKHF
GEAALERLTADLFALTEVEGIGFLTADKLWQSQGGALDDARRLTAAAVYALQQAAQQGGH
SYLPRSRAERGVAHYTRVTQAQAQMAVDTAVELGRLSDDTPPLLDTQDPLHDGTRIYLPH
VLRAEKKLAGLIRTLLATPPSGEWSVPAGASKGLSEEQAQILDLLEDHRLVVLTGGPGTG
KSTTTRAVADLAERLGLEVGLCAPTGKAARRLGEVTGRTASTIHRLLGYGPAGFRHNHLE
PAPYDLLIVDEVSMCGDGLMLSLLAAVPPGSRVLLVGDTDQLPPVDAGLPLHALTHAAPT
VRLTQVYRQAAENPIIRAAHGLLQGQAPAWGDPRLNLIETEPDGGARRVALTVRELGGPT
QVQVLTPMRKGPLGVEMLNHQLQSLFNPGQGGVRIGDSEARAGDVVVQTKNDYTNEIFNG
TLGTVLKAEGGRLTVDFDGNIVDLAGAELFNLQLGYALTVHRAQGSEWGTVLGVLHEAHM
PMLSRNLVYTALTRARERFYAVGSATSWQKAAVRQREERNTALLERIKAR
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgtcacacgccctccccaatgaaccgttccgggtgaccgggggcgtcaataaggtgcgt
ttccgcgccgaaagcggctttaccgtcatgaccgcccggctgcgcaacaacgacggcgag
gacccggacgccaccgtgatcggcatgatgcctccgctggacgccggggacagcttcagc
gctgacgtgctgatggaagagcaccgcgagtacggctaccagtaccgcgtactgaatctg
gtgctggaggccaccccggccgatctgactgaagctggcgttgccgcgtatctggaagcg
cgggtcggcggcgtgggcaaggtcctggcaggacgcattgccaaggcctttggacccgcg
accttcgatctgctggaaaccgagccggacaagctgcttcaggtgcctggagtcaccgcg
tccaccctgcacaagatggtgcagagctggtcgcagcagggcctggaacgccggctcctg
gccggtctccagggcctggggctgaccatctcacaggcccagcgggccgtcaagcatttt
ggagaagccgcactcgaacgcctgactgccgatcttttcgcactcacggaagtcgagggc
atcgggttcctcacggccgacaagctgtggcagtcgcaaggcggcgcactcgatgatgcc
agacggctgaccgctgcggccgtgtacgccctgcagcaggcagcgcaacagggtggacac
tcctatctgccgcgcagccgggccgagcggggcgtggcccactacacgcgggtaacgcag
gcgcaggcccagatggccgtcgacactgccgtggaactcgggcgcctcagtgacgacacg
ccgcctctgctggacacccaggaccctctgcacgacggcacacgtatctatctgccgcac
gtcctgcgggccgagaagaaactggctgggctgatccgcaccctgctggccacgccgccc
agcggcgagtggagcgtgccggcgggcgcctccaaagggctctcggaggagcaggcccag
attctcgacctgcttgaagatcaccgtctggtggtgctgactggcggcccaggaaccggg
aaaagcacgacgacccgcgccgttgccgacctggccgagcgtcttgggctggaagtcggg
ctgtgcgccccgaccggcaaggcagcccggcgtctgggtgaggtgaccggccgcaccgcc
agtacgattcaccggttactgggttacggcccggccggcttccggcacaaccacctggaa
ccggccccctacgacctgctgatcgtggacgaggtcagcatgtgcggcgacggcctgatg
ctctcgctgctcgcagccgtcccgcccggctcgcgggtgctgctggtgggcgataccgat
cagctgcccccggtagacgccgggctgccgcttcacgcgctgacacacgcggcaccgacc
gtccggctcacgcaggtgtaccggcaggccgccgagaaccccatcatccgtgcggcgcac
ggcctgctccaggggcaggccccggcctggggcgacccgcgcctgaatctgatcgaaacg
gagccggacggcggcgcgcggcgcgtggccctgacggtgcgtgaactcggtggccccacc
caggttcaggtgctgacccccatgcgcaaaggaccgctgggggtggagatgctcaaccat
cagttgcagagcctgttcaatcccggccagggtggcgtgcggatcggcgacagcgaggca
cgggccggtgatgtggtcgtgcagaccaagaacgactacaccaacgagatcttcaacggc
acactaggcaccgtactcaaggccgaaggcgggcgactcacggtggactttgatggcaat
atcgtggacctggccggggctgagctgttcaacctccagctgggctacgccctgacggtg
caccgggctcagggcagcgaatggggcaccgtactgggcgtgctgcacgaggctcacatg
cccatgctgtcgcgcaatctggtgtacaccgccctgacccgcgcccgcgagcgcttctac
gcggtgggctcagcgacctcctggcagaaggcggccgtacgtcagcgcgaagagcgcaac
acggccttgctggagcggatcaaggccagatag

DBGET integrated database retrieval system