KEGG   Deinococcus deserti: Deide_16480Help
Entry
Deide_16480       CDS       T00880                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ddr  Deinococcus deserti
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Deide_16480
Enzymes [BR:ddr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Deide_16480
    3.5.1.-  
     Deide_16480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2007325..2008065)
Genome map
AA seq 246 aa AA seqDB search
MNLSLQRVGWIVDVQNDFMRPADQGGRLYVHNLFDGGQDPGAVQIVPALIRATEWMRAHC
DALVYTGDWHHIGDAEIDPMAPDAARGTYPPHCMGLSSDAREREGAEIISEIRPENPLIL
QRDATGPDAREIARQAVAEQRPVFVQKSRFSVFEGNAAADAFVRALREQLGGAIEVYVVG
VARDVCVKGAVEGLLAQERRIPVTVITDATWGLGLEQADESYARWLEAGAALISTEGLQV
RSSSAS
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgtcccttcaacgcgtcggctggattgtcgatgtccagaacgatttcatgcgc
ccagcggatcagggcgggcgcctgtatgtgcataacctgtttgatggcggtcaggatccg
ggcgccgttcagattgttccggccctgatccgggcgacagagtggatgcgcgcgcactgt
gacgcgctggtgtacaccggtgactggcatcacatcggtgacgctgaaattgaccccatg
gctccggacgcagcccggggaacctatccaccgcactgcatggggctttcctctgacgcg
cgggaacgtgagggcgcggagattatcagcgagatccgccctgagaacccgctgattctg
cagcgtgacgccaccggacctgatgcccgtgagattgcgcgccaggctgttgccgagcag
cggcctgtctttgttcaaaagagccgcttcagtgtgttcgagggcaatgcggcagctgat
gctttcgtgcgtgcgctgcgtgagcaactgggcggcgccattgaggtctacgtcgttggt
gtggcacgtgacgtatgtgtcaagggggccgtggaagggctgttggcgcaggaacgacgc
attcctgtcacggtcatcaccgacgcgacctggggtctggggctggaacaggcagacgag
agctatgcccggtggctggaggctggcgcggccctgatcagcaccgagggacttcaggtg
cgcagctcatctgcgtcataa

DBGET integrated database retrieval system