KEGG   Deinococcus deserti: Deide_16980Help
Entry
Deide_16980       CDS       T00880                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ddr  Deinococcus deserti
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Deide_16980 (malQ)
Enzymes [BR:ddr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Deide_16980 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2062338..2063843)
Genome map
AA seq 501 aa AA seqDB search
MTIPRSSGVLLHPTSLPGPYGIGELGTQARHFIDWLAAAGQHYWQVMPLGPTGYGDSPYQ
AFSAFAGNPYLIDLTTLREEGLLGDADFAALPAFNPDKVDFGLQYVWRNQMLERAHAAFL
GGKASHLRAELEAFIQAEASWLDDYALFTALKDAHGGLPWNAWPSAVRDRQPEALATARA
SLSESLERVRFIQFLFFRQWTAIREYARGKGIQVIGDIPIFVAMDSSDAWANREQFYFDD
QGQPTVVAGVPPDYFSETGQLWGNPLYNWDAMRQSGYQWWIDRFQGSLKLYDVIRIDHFR
GFAGYWEIPFPAETAVHGRWVPAPGHEMFAAVRGALGNLPIIAEDLGVITPDVEQLRDDF
EFPGMAVLQFAFGGGDFSVNDFLPHNLRENQVVYTGTHDNDTTRGWWRHADDQEKHNFRT
YTSSNPTEESFAWELMRLAFESRANLAVVPLQDIMNLGTEARMNLPGTTGEHNWTWRYRG
PDLRPDLAQRLRELTDRTGRL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaccattccacgctcgagcggcgtcctgctgcaccctaccagccttcctggcccctac
ggcatcggggaactgggtacacaggcccggcatttcattgactggctggctgctgccggc
cagcactactggcaggtcatgccgctgggccccaccgggtatggcgacagcccctatcag
gccttcagcgccttcgccggcaacccctatctgattgatctgactaccctccgcgaggag
ggtctgctgggtgacgcggacttcgcggcgctgcctgccttcaacccggacaaggtggat
ttcgggctgcagtatgtctggcgcaatcagatgctggagcgggcccacgccgcgtttctt
ggggggaaagccagtcacctgcgcgctgagcttgaggcattcatccaggcggaggccagc
tggctggatgactacgccctgttcaccgccctcaaggacgctcacgggggcctgccctgg
aatgcctggccgtcggctgtgcgtgaccgccagccggaagccctggctacggcccgtgcc
agcctgagcgagtctctggagcgcgtgcgcttcattcagttcctgttcttccgccagtgg
accgccatccgtgaatatgcacggggcaagggcattcaggtgatcggcgatattccgatt
ttcgtggccatggacagcagtgacgcctgggccaaccgcgagcagttctactttgacgac
cagggccagcccaccgtggttgccggtgtgccgccagactatttcagcgagaccgggcag
ctgtggggcaacccgctgtacaactgggacgctatgcgccagagcggttatcagtggtgg
attgaccggttccagggcagcctgaagctgtacgacgtgatccgcatcgaccacttcagg
ggctttgccggatactgggagattcccttcccggcggaaacggccgtgcatggccgctgg
gtgccggcccccgggcacgagatgtttgccgccgtgcgcggggcactgggcaaccttcct
atcattgccgaggacctgggcgtgatcacgccggacgtggaacaactgcgtgacgatttc
gagttccctggtatggccgtgctgcagttcgcttttggcggcggagacttcagcgtcaac
gatttcctgccgcacaaccttcgcgagaatcaggtggtgtacaccggcacgcacgacaac
gacaccacccggggctggtggcgtcatgccgacgaccaggaaaagcataatttccgcacc
tacaccagcagcaatccgaccgaggaaagcttcgcctgggagttgatgcgtctggctttt
gaaagccgcgcgaatctggcggttgtgcccctgcaagacatcatgaatctggggaccgag
gcgcgcatgaacctgccgggcaccacgggagagcacaactggacctggcggtaccggggt
ccggacctgcgccctgatctggcccagaggctgcgcgaactgaccgaccggaccggccgg
ctctaa

DBGET integrated database retrieval system