KEGG   Deinococcus deserti: Deide_17450Help
Entry
Deide_17450       CDS       T00880                                 

Definition
bifunctional peptidase M42/cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ddr  Deinococcus deserti
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Deide_17450
Enzymes [BR:ddr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Deide_17450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2119506..2120555
Genome map
AA seq 349 aa AA seqDB search
MSKINQEFLFALLREAAPSGFERRAADVWLKEAATFARTSEDHYGNVYAELGPEGAPAII
LTGHLDEIGLMVSHVNDQGFLHVLPLGGWDPQVLVGQRIRLLAPEGDLIGVIGKKAIHVM
DEDDRNKASKLEDLWIDVDMTAEDARKRIPVGTVAVIEQPTVMVGNKIVSRALDNRVGGF
IVLEALRALKDADLKHRIVAVGTSQEEIGSYGSKTAAHRVRPIAGVAVDVTHETTQPGVK
AEKYGVVPFGSGANLTVGAMVSPVIFRQMKEAAEREGIPHSVSASPRLTFTDADTMMLSR
EGVPGAVVSIPNRYMHSPNEMVDAGDVKACIDILAAWVRGLEAEGSFLR
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaatcaatcaggagtttctgttcgccctgctccgcgaagctgcacccagcggt
tttgagcgccgcgctgccgacgtgtggctgaaagaagccgctacttttgcccggaccagc
gaagaccactacgggaacgtctatgccgagctggggccggaaggtgcgccagcaatcatc
ctgaccggtcacctggacgagatcggcctgatggtcagccacgtcaatgatcagggattc
ctgcacgtgctgccgctgggcggctgggacccgcaggtgctggttggtcaacgtatacgc
ctgcttgccccggaaggcgacctgatcggtgtaatcgggaaaaaggccattcacgtcatg
gacgaggatgaccgcaacaaggccagcaagcttgaggacctgtggatcgacgtggacatg
acggcagaggacgcgcgcaagcgcattccggttggtaccgttgccgtgatcgagcagccc
actgtcatggtaggcaacaagatcgtaagccgggcactggacaaccgcgtcgggggattt
atcgtgcttgaagccctgcgtgcgctgaaagacgccgacctgaaacaccgtatcgtggcg
gtgggcaccagccaggaagaaatcggttcatacggcagtaaaaccgctgcccaccgggtg
cggcctattgccggggtggcggtggacgtcacccatgaaaccacccagccgggcgtgaaa
gccgagaagtacggcgtggtgccgttcggcagcggcgcaaacctcaccgtcggcgccatg
gtcagcccggtgatcttccggcagatgaaggaagctgccgagcgcgagggcattccccac
agtgtctctgccagcccccgcctgaccttcacggacgcggacaccatgatgctctcgcgt
gaaggggtgcccggggcagtggtcagcattcccaaccgctatatgcacagcccgaacgaa
atggtcgatgccggagacgtcaaagcctgcattgacattctcgcggcttgggtccgcggc
ctggaggcagagggcagctttctgcggtaa

DBGET integrated database retrieval system