KEGG   Deinococcus deserti: Deide_17450Help
Entry
Deide_17450       CDS       T00880                                 

Definition
(GenBank) putative bifunctional protein: peptidase M42/cellulase
Organism
ddr  Deinococcus deserti
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2119506..2120555
Genome map
AA seq 349 aa AA seqDB search
MSKINQEFLFALLREAAPSGFERRAADVWLKEAATFARTSEDHYGNVYAELGPEGAPAII
LTGHLDEIGLMVSHVNDQGFLHVLPLGGWDPQVLVGQRIRLLAPEGDLIGVIGKKAIHVM
DEDDRNKASKLEDLWIDVDMTAEDARKRIPVGTVAVIEQPTVMVGNKIVSRALDNRVGGF
IVLEALRALKDADLKHRIVAVGTSQEEIGSYGSKTAAHRVRPIAGVAVDVTHETTQPGVK
AEKYGVVPFGSGANLTVGAMVSPVIFRQMKEAAEREGIPHSVSASPRLTFTDADTMMLSR
EGVPGAVVSIPNRYMHSPNEMVDAGDVKACIDILAAWVRGLEAEGSFLR
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaatcaatcaggagtttctgttcgccctgctccgcgaagctgcacccagcggt
tttgagcgccgcgctgccgacgtgtggctgaaagaagccgctacttttgcccggaccagc
gaagaccactacgggaacgtctatgccgagctggggccggaaggtgcgccagcaatcatc
ctgaccggtcacctggacgagatcggcctgatggtcagccacgtcaatgatcagggattc
ctgcacgtgctgccgctgggcggctgggacccgcaggtgctggttggtcaacgtatacgc
ctgcttgccccggaaggcgacctgatcggtgtaatcgggaaaaaggccattcacgtcatg
gacgaggatgaccgcaacaaggccagcaagcttgaggacctgtggatcgacgtggacatg
acggcagaggacgcgcgcaagcgcattccggttggtaccgttgccgtgatcgagcagccc
actgtcatggtaggcaacaagatcgtaagccgggcactggacaaccgcgtcgggggattt
atcgtgcttgaagccctgcgtgcgctgaaagacgccgacctgaaacaccgtatcgtggcg
gtgggcaccagccaggaagaaatcggttcatacggcagtaaaaccgctgcccaccgggtg
cggcctattgccggggtggcggtggacgtcacccatgaaaccacccagccgggcgtgaaa
gccgagaagtacggcgtggtgccgttcggcagcggcgcaaacctcaccgtcggcgccatg
gtcagcccggtgatcttccggcagatgaaggaagctgccgagcgcgagggcattccccac
agtgtctctgccagcccccgcctgaccttcacggacgcggacaccatgatgctctcgcgt
gaaggggtgcccggggcagtggtcagcattcccaaccgctatatgcacagcccgaacgaa
atggtcgatgccggagacgtcaaagcctgcattgacattctcgcggcttgggtccgcggc
ctggaggcagagggcagctttctgcggtaa

DBGET integrated database retrieval system