KEGG   Deinococcus deserti: Deide_18010Help
Entry
Deide_18010       CDS       T00880                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ddr  Deinococcus deserti
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ddr00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ddr00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2193987..2195264
Genome map
AA seq 425 aa AA seqDB search
MQLTPLHIQGGRELRGEIAVQGSKNAALPIIVASLLSSEKVTLHGIPRLSDVYTILDLVH
HIGTQHQWVGPNSLELHTPSIVNTDAPYALVNKMRASFVVLGAILARAGQARVSMPGGCA
WGPRPVDQHVKALRALGAEISEEGGNFHARRQGSLNGTFVFELLTVGGTHNAVLAAVLGD
GVVTLENASIDTDVVDLIEFLNSLGADIQGAGTNTLVIRGVQQLRGGEYTVIPDRIEAGT
FMMLAAATRSQLTVRNVRPDHLRAVSAKLQEMGVDILEAGNSLIVDARQRELRPVNVTTQ
SYPGFPTDVQPQMSALLATVPGTSVVQDPVYPDRLTHVAELHRMGANITVSGYTQVIQGS
ALHAAPVKAADLRAGAALFIAGLTCTGETVIDGVQYLNRGYENLAERLCGIGATAQQTEL
AVAMD
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcaactgaccccactgcacattcaaggaggccgcgaacttcgcggtgaaatcgccgtt
cagggcagcaaaaatgcagccctgcccattattgtggccagcctcctgagcagtgagaaa
gtcaccctgcatggcatcccgcgcctgagcgacgtctacaccattcttgatctggtgcac
cacatcggcacccagcaccagtgggtcgggcccaacagcctcgaactgcatacccccagc
atcgtcaacaccgacgcgccctatgccctggtcaacaagatgcgcgcaagtttcgtggtg
cttggagccattctggcgcgggccggccaggcacgggtatctatgcctggaggctgtgcg
tggggcccacgcccggtggaccagcatgtcaaggcgctgcgcgccctgggcgctgagatc
agtgaggaggggggcaacttccacgcccgccgccaaggcagcctcaacggcacctttgtg
tttgaacttctgaccgtcggcggcactcacaatgcagtcctggccgcagtgctgggcgac
ggtgtagtgacgctggaaaacgccagcatcgataccgacgtcgtggacctgattgagttc
ctgaacagcctgggcgctgacatacagggcgccggcaccaacaccctggtcatccgtgga
gtgcagcagctgcgcggcggcgaatacaccgtgattcccgaccgcatcgaagccgggact
ttcatgatgctggcagctgcgacccgcagccagctgaccgtacgcaacgtccgccctgac
cacctgcgcgccgtgagtgccaagcttcaggaaatgggcgtggacattttggaagctggc
aacagcctgatcgtagacgcgcggcagcgcgagctgcgtccggtgaatgtgaccacccag
agctacccgggctttcctaccgacgtacagccgcagatgagcgccttgctggccactgtg
ccggggaccagtgtcgtgcaggaccctgtttacccagaccgcctgacgcatgtggccgaa
ctgcaccgtatgggcgccaacatcaccgtcagtggctacacccaggtgatccagggcagt
gccctgcacgccgcaccggtcaaggctgcagatctgcgtgctggtgctgcgctgttcatt
gccggcctgacctgcaccggtgaaaccgtgattgacggcgtgcagtacctcaaccgcggc
tatgagaacctcgccgagcgactgtgtggcatcggagccaccgcacagcagacagaactc
gctgtcgcgatggactaa

DBGET integrated database retrieval system