KEGG   Deinococcus deserti: Deide_18010Help
Entry
Deide_18010       CDS       T00880                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ddr  Deinococcus deserti
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Deide_18010 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Deide_18010 (murA)
Enzymes [BR:ddr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Deide_18010 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2193987..2195264
Genome map
AA seq 425 aa AA seqDB search
MQLTPLHIQGGRELRGEIAVQGSKNAALPIIVASLLSSEKVTLHGIPRLSDVYTILDLVH
HIGTQHQWVGPNSLELHTPSIVNTDAPYALVNKMRASFVVLGAILARAGQARVSMPGGCA
WGPRPVDQHVKALRALGAEISEEGGNFHARRQGSLNGTFVFELLTVGGTHNAVLAAVLGD
GVVTLENASIDTDVVDLIEFLNSLGADIQGAGTNTLVIRGVQQLRGGEYTVIPDRIEAGT
FMMLAAATRSQLTVRNVRPDHLRAVSAKLQEMGVDILEAGNSLIVDARQRELRPVNVTTQ
SYPGFPTDVQPQMSALLATVPGTSVVQDPVYPDRLTHVAELHRMGANITVSGYTQVIQGS
ALHAAPVKAADLRAGAALFIAGLTCTGETVIDGVQYLNRGYENLAERLCGIGATAQQTEL
AVAMD
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcaactgaccccactgcacattcaaggaggccgcgaacttcgcggtgaaatcgccgtt
cagggcagcaaaaatgcagccctgcccattattgtggccagcctcctgagcagtgagaaa
gtcaccctgcatggcatcccgcgcctgagcgacgtctacaccattcttgatctggtgcac
cacatcggcacccagcaccagtgggtcgggcccaacagcctcgaactgcatacccccagc
atcgtcaacaccgacgcgccctatgccctggtcaacaagatgcgcgcaagtttcgtggtg
cttggagccattctggcgcgggccggccaggcacgggtatctatgcctggaggctgtgcg
tggggcccacgcccggtggaccagcatgtcaaggcgctgcgcgccctgggcgctgagatc
agtgaggaggggggcaacttccacgcccgccgccaaggcagcctcaacggcacctttgtg
tttgaacttctgaccgtcggcggcactcacaatgcagtcctggccgcagtgctgggcgac
ggtgtagtgacgctggaaaacgccagcatcgataccgacgtcgtggacctgattgagttc
ctgaacagcctgggcgctgacatacagggcgccggcaccaacaccctggtcatccgtgga
gtgcagcagctgcgcggcggcgaatacaccgtgattcccgaccgcatcgaagccgggact
ttcatgatgctggcagctgcgacccgcagccagctgaccgtacgcaacgtccgccctgac
cacctgcgcgccgtgagtgccaagcttcaggaaatgggcgtggacattttggaagctggc
aacagcctgatcgtagacgcgcggcagcgcgagctgcgtccggtgaatgtgaccacccag
agctacccgggctttcctaccgacgtacagccgcagatgagcgccttgctggccactgtg
ccggggaccagtgtcgtgcaggaccctgtttacccagaccgcctgacgcatgtggccgaa
ctgcaccgtatgggcgccaacatcaccgtcagtggctacacccaggtgatccagggcagt
gccctgcacgccgcaccggtcaaggctgcagatctgcgtgctggtgctgcgctgttcatt
gccggcctgacctgcaccggtgaaaccgtgattgacggcgtgcagtacctcaaccgcggc
tatgagaacctcgccgagcgactgtgtggcatcggagccaccgcacagcagacagaactc
gctgtcgcgatggactaa

DBGET integrated database retrieval system