KEGG   Deinococcus deserti: Deide_18180Help
Entry
Deide_18180       CDS       T00880                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ddr  Deinococcus deserti
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Deide_18180
Enzymes [BR:ddr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Deide_18180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2215237..2216070
Genome map
AA seq 277 aa AA seqDB search
MDWFGGLRVLSLESRRSEEMTTLIQKYGGIPTVAPSMREQKLDLTAALSRFEADLRAGEV
HAVVCMTGVGTRMFLQDLLARDAETLARLQGVPFVVRGSKPAQALKTFGLSGISVPRPHT
WHEVQDHLLQTLQAGQHAVMLEYGDAPPAAMLRTLAQAGIRVTSVPVYRCAFPADTLPLA
HAIRDTVLFGQDVLLLSSGTQVLHLLKFAERLKLQDELRVALNRMVVVSIGPACSESAGE
LGIRIDLECNPHKMGILVRMAAEHAPGLLRQRLDRVS
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggattggttcggaggcttgagggtcctgagtctggagtcccgccgctcggaggaaatg
accaccctgatccagaagtacggtggtattcctaccgtggcgcccagcatgcgcgaacag
aagctggatctgacggccgccctgtcacggttcgaggcggacctgcgtgccggagaggtt
cacgcggtggtctgcatgaccggcgtaggaacgcggatgttcctccaggacctgctggcc
cgggacgccgaaacactggcgcggctgcagggcgtgccctttgtggtgcgcggcagcaag
ccggcgcaggcactcaagactttcggcctgagtgggatcagcgtgccgcgtccacatacc
tggcatgaagtccaggaccatctgctgcagaccctgcaggctgggcagcacgcggtgatg
ctggagtacggcgacgcgccgccagcggccatgctgcgcaccctggcccaggccggcatc
cgggtgaccagcgtcccggtgtaccgctgcgcctttcccgccgacaccctgccattggcc
cacgccatccgcgacacggtgcttttcgggcaggacgtgctgctgctgtccagcggcacc
caggtgctgcatctgctgaagttcgccgagcgcctgaagctgcaggatgaactgcgcgtg
gccctgaaccgtatggtggtcgtcagcatcggccccgcgtgcagcgagagcgccggtgaa
ctgggaatccgcatcgatctggaatgcaatccgcacaagatgggcattttggtgcgcatg
gcggcggagcacgctccaggtctgctgcgccagcgcctggacagggtgagctag

DBGET integrated database retrieval system