KEGG   Deinococcus deserti: Deide_18180Help
Entry
Deide_18180       CDS       T00880                                 

Definition
(GenBank) putative uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ddr  Deinococcus deserti
Pathway
ddr00860  Porphyrin and chlorophyll metabolism
ddr01100  Metabolic pathways
ddr01110  Biosynthesis of secondary metabolites
ddr01120  Microbial metabolism in diverse environments
Module
ddr_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Deide_18180
Enzymes [BR:ddr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Deide_18180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 DUF3440
Motif
Other DBs
NCBI-ProteinID: ACO46805
UniProt: C1CX88
Position
2215237..2216070
Genome map
AA seq 277 aa AA seqDB search
MDWFGGLRVLSLESRRSEEMTTLIQKYGGIPTVAPSMREQKLDLTAALSRFEADLRAGEV
HAVVCMTGVGTRMFLQDLLARDAETLARLQGVPFVVRGSKPAQALKTFGLSGISVPRPHT
WHEVQDHLLQTLQAGQHAVMLEYGDAPPAAMLRTLAQAGIRVTSVPVYRCAFPADTLPLA
HAIRDTVLFGQDVLLLSSGTQVLHLLKFAERLKLQDELRVALNRMVVVSIGPACSESAGE
LGIRIDLECNPHKMGILVRMAAEHAPGLLRQRLDRVS
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggattggttcggaggcttgagggtcctgagtctggagtcccgccgctcggaggaaatg
accaccctgatccagaagtacggtggtattcctaccgtggcgcccagcatgcgcgaacag
aagctggatctgacggccgccctgtcacggttcgaggcggacctgcgtgccggagaggtt
cacgcggtggtctgcatgaccggcgtaggaacgcggatgttcctccaggacctgctggcc
cgggacgccgaaacactggcgcggctgcagggcgtgccctttgtggtgcgcggcagcaag
ccggcgcaggcactcaagactttcggcctgagtgggatcagcgtgccgcgtccacatacc
tggcatgaagtccaggaccatctgctgcagaccctgcaggctgggcagcacgcggtgatg
ctggagtacggcgacgcgccgccagcggccatgctgcgcaccctggcccaggccggcatc
cgggtgaccagcgtcccggtgtaccgctgcgcctttcccgccgacaccctgccattggcc
cacgccatccgcgacacggtgcttttcgggcaggacgtgctgctgctgtccagcggcacc
caggtgctgcatctgctgaagttcgccgagcgcctgaagctgcaggatgaactgcgcgtg
gccctgaaccgtatggtggtcgtcagcatcggccccgcgtgcagcgagagcgccggtgaa
ctgggaatccgcatcgatctggaatgcaatccgcacaagatgggcattttggtgcgcatg
gcggcggagcacgctccaggtctgctgcgccagcgcctggacagggtgagctag

DBGET integrated database retrieval system