KEGG   Deinococcus deserti: Deide_1p00470Help
Entry
Deide_1p00470     CDS       T00880                                 

Gene name
cheB
Definition
protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ddr  Deinococcus deserti
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ddr02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:ddr02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
p1:80456..81496
Genome map
AA seq 346 aa AA seqDB search
MTDFPLVVIGASAGGVSALMKLCAQLPSSFPAAVLVVQHVSPAHPSMLPRILSAAGTLHA
IHPRDGQTLHPGMIYVAPPDHHLLVDGETVLLSRGPRENRSRPAIDVLFRSAAVEAGSRV
IGVVLTGNLDDGTSGLHVIKQAGGLAVVQDPDDAEFASMPRSALNAVKVDHVAPLSELGA
LLASLVDDRARNHRPTPLASEDVRRLEVELGVAREEHALSKGVTRLGAPSPLTCPECHGT
LIEIREGTLVRFRCHSGHAYTAGTLLTEVSESVESKAYQALRALGETVILLRQLSDQRQK
QGDPAGAEAFLARAREVEASSEGIRALVRTTRALSVEKVERPDFDG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgacggactttcccctggtggtcattggggcctcagctggtggtgtctcggccctgatg
aaactctgtgcccaacttcccagctcctttccggccgcagtgctggtggtccagcacgtc
tccccggcccatcccagcatgctccccagaatcctcagtgccgctggcaccctgcacgcc
atccatccccgtgatggccagacgctgcatcctggaatgatctacgtcgctccgcctgac
catcacctgctggtggatggtgaaaccgtcctgctgtcccggggccccagagaaaaccgc
tcccgtcccgccattgacgttctgttccgctcggcggcagtcgaggcagggagccgcgtg
atcggggtggtcctgactggaaacctggatgatggcacgtccggccttcatgtcatcaaa
caggccggcggtctggccgtggtgcaggacccggatgacgcagagttcgcctcgatgcca
cgtagcgctctgaatgctgtgaaggttgaccacgttgcgccgctctcggaactgggagcg
ctgctggctagcctggtggatgaccgagccaggaaccacagacctacaccgctggcctct
gaggacgtacgccgccttgaagttgagctgggggttgcccgggaagagcatgccctgagc
aaaggggtgacccggctgggcgcaccgtcgccgctgacctgtccggagtgtcacggcacc
ttgatcgagattcgggaaggcacccttgtgaggttccggtgccactctggtcatgcctac
acggcaggcaccctgctgaccgaagtcagtgagtcggttgagtccaaggcttatcaggcg
ttgcgggcactgggagaaacggtgattctgctccggcaactgagcgatcagcgccagaag
cagggcgacccggcgggagcagaagcatttctggcgcgggcccgtgaggtggaggccagc
agtgaaggcatccgcgccctggtgcggacaaccagagccctgagtgtcgagaaggtagag
cggccggacttcgacggctga

DBGET integrated database retrieval system