KEGG   Deinococcus deserti: Deide_20310Help
Entry
Deide_20310       CDS       T00880                                 

Gene name
asnB
Definition
(GenBank) putative asparagine synthetase (glutamine-hydrolyzing)
  KO
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ddr  Deinococcus deserti
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Deide_20310 (asnB)
Enzymes [BR:ddr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Deide_20310 (asnB)
Peptidases [BR:ddr01002]
 Cysteine Peptidases
  Family C44
   Deide_20310 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2445217..2447082)
Genome map
AA seq 621 aa AA seqDB search
MCGISGAVGAHLNAPQTALHRSLDAISHRGPDGQGTYFQSQVCMGMRRLAIIDLEGGDQP
IYNEDETVAVVFNGEIYNYRELMAGLKSRGHTFATDSDTEVLVHLYEEKGERMLEDLRGM
FAFSIHDTRDGSLFLARDRFGKKPLYYTRPASGGLLYASELKALRPLARAAGERWQINDQ
AIYDYLSLGVVPQPSTVYLGVYALPPGSWMRFREEHLEIQAYWQPEFHPKLTLSYDEAKE
RTRAEIGEATRLRLRSDVPLGVFLSGGVDSSVIAYEAAQQLGSTLQTFTVATGEGFDESP
VAQRTAAHLGVKNTILKLEVSPLEGLQEMVRAYDQPYSDSSAIPSLGISRLARQHVTVVL
NGDGGDEVFAGYRRYVAAVRSAALDVVPKGVARTLAAGLAPFAGARRSPLGFAARFTRGL
ALSPAERYLAWTTDMLREGDKQRVWRGGPVLPTEERIAAIQRPELGALDGQLATDARINL
LSDLLVKMDIATMAHSLEGRSPLLDHRVAEFAWRLPDAYRVRGGTPKAVLRDAYRSRLPD
EVIGGAKRGFEIPLVRWLQGELRPILLDTLGGAEALVRGYVDGAFIDALLRREVMTDRNW
AYIVYALLVLELWLQEEKSRE
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattagtggtgcagtcggagcccatctgaatgcccctcagacagctctacac
aggtcactagatgccatctcccatcgtggcccggatggtcagggcacctattttcagagc
caagtgtgcatgggaatgcggcgcttggcaattatcgatctggagggtggagaccagccg
atctataatgaggacgagacggtggccgttgtattcaacggggaaatctacaactaccga
gagttgatggcaggactcaaatcgcgtgggcatacctttgccactgactcggacacggaa
gtcttggttcacctgtacgaggagaagggcgagcgcatgctggaggacctgcgcggcatg
ttcgccttctccatccacgacacccgcgatggcagcctctttctggcccgcgaccgcttc
ggcaagaagccgctgtactacacgcggcctgcctcaggcggtcttctgtacgcctcagaa
ctcaaggcgcttcggcccctggcgcgcgcggcaggcgagcggtggcagatcaacgaccag
gccatctatgactatctgtcgctgggcgtggtgccgcagcccagtacggtttacctgggt
gtctacgccctgccgccaggaagttggatgcgttttcgggaagagcacctggagattcag
gcctactggcaaccggaatttcatccaaagctgacgctgagctacgatgaagctaaggaa
cgtacgcgggccgaaattggggaggccacgcgccttcgtctgcgctcggatgtcccgctg
ggtgtattcctatcgggcggggttgacagcagcgtgatcgcgtacgaggcggcgcagcag
ttgggcagcacgctgcagaccttcacagtcgcgaccggcgagggcttcgacgaatctcct
gtcgcgcagcgcacagcagctcacctcggcgtaaaaaacaccatcctgaaactggaggta
agcccgctggagggattgcaggaaatggtgcgtgcatacgaccagccctacagcgattcc
agtgccattcccagtctgggaatctcgagattggctcggcagcacgtaactgtggtgctt
aatggagacggtggtgatgaggtattcgctggctaccgccggtacgtggcagcggtccgc
agtgcggcgctggatgttgtgcccaagggcgtggcgcgcacacttgcggcaggtctggcg
ccattcgcaggggcacggcgcagcccgttggggttcgccgcacgctttacgcgaggcttg
gccctgtcacctgccgagcgttatctcgcctggacgaccgatatgctccgcgagggagac
aaacagcgggtctggcgtggaggaccggtgctgccaaccgaggagcgaatcgctgcgatt
cagcgcccggaactgggggcgctcgatgggcaactggccactgatgcccgcatcaatctg
ctaagtgatctgctggtcaagatggacatagccacaatggctcactctctcgaaggtcgc
tcccctttgctggaccaccgggtggcggagttcgcctggcggcttcccgacgcctaccgc
gtgcgggggggaacacccaaggccgtgctgcgtgacgcttaccgcagccgcctccctgat
gaggtgatcggtggagccaagcggggctttgaaattccgctggtgaggtggttgcaggga
gaactgcggcctatcctgctggatacgctgggcggcgccgaggctctggtccggggttat
gtggatggagcctttatcgacgcattgctgcgccgcgaagtgatgaccgaccgcaactgg
gcatacatcgtgtacgcgttgctggtgctggagttatggttgcaagaggagaaaagccgt
gagtaa

DBGET integrated database retrieval system