KEGG   Deinococcus deserti: Deide_21440Help
Entry
Deide_21440       CDS       T00880                                 

Gene name
sucB
Definition
dihydrolipoyllysine-residue succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ddr  Deinococcus deserti
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deide_21440 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Deide_21440 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    Deide_21440 (sucB)
Enzymes [BR:ddr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Deide_21440 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2585846..2587150
Genome map
AA seq 434 aa AA seqDB search
MADIKVPVFSESVSEGTLLTWHKKPGDAIKRGEVLAEIETDKVVLEVTALQDGVLTSIAK
NEGDTVLSEELLGTVGEAGSAPAPAAAQSADPASGAVVGQASAGGTATTPDTTDLGNEAT
RRDDLSPAVRKIVAESGLNPAQIPATGPRGNITKEDAVVAAQGGLTYQGPQSAAQPASMQ
ASAPAAQAPAQAQPAVAVPGGPRPEQRVPMTRIRQRISERLKDVQNTAAILTTFNEVNMK
PSMDLRKKYQDQFVAKHGTKLGFMSLFVRAATEALKAFPVVNASVEGKDIIYHGYYDIGI
AVASDRGLVVPILRDTDQMSLAGIEKEIAGFAAKAKSGKLTMEDMSGGTFSITNGGTFGS
MMSTPIINAPQSAILGMHNIIERPIAQNGQVVIAPMMYIALSYDHRIIDGKEAVQFLAMV
KNLLEDPARMLLEL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggcggacatcaaggttccagttttttccgagtcggtaagcgagggtacgctgctgaca
tggcacaagaaacccggcgacgcgatcaagcgcggcgaggttctcgccgagattgagacc
gacaaggtcgtgctggaagtgaccgcgctgcaagacggtgtgctgaccagtatcgccaag
aacgagggcgacacggtcctcagcgaggaattgctgggcacggtcggtgaagccggaagc
gcacctgccccagcagcggcccagtcggctgatccggccagcggcgcagtggtgggccag
gccagcgccggtggcaccgccaccacccccgacaccacggatctgggcaacgaggcgacg
cgacgcgacgacctgtctcctgccgtgcgcaagattgtcgcggaaagcgggttgaacccc
gcgcagattcccgcaaccggtcccaggggcaacatcaccaaggaagacgccgtcgttgcg
gcccagggcggcctgacgtaccagggcccccagagcgccgcgcagcccgcgagcatgcag
gcgtctgctccggcagcccaggcccccgcgcaggcccagcccgctgtggctgtccccggc
ggcccccgtcccgagcagcgcgttcccatgacgcgcatccgccagcgcatcagcgagcgc
ctcaaggacgtgcagaacacggccgcgattctcacgaccttcaacgaagtcaacatgaag
ccgtcgatggaccttcgcaagaagtaccaggaccagttcgttgccaaacacggcaccaag
ctgggcttcatgagcctgttcgtgcgcgctgccaccgaggccctcaaggccttcccggtg
gtcaatgccagcgttgagggcaaggacatcatctaccacggctactacgacatcggcatt
gccgtggcctctgaccgtggtctggtggtgcctatcctgcgtgacaccgaccagatgagc
ctggcggggatcgagaaggaaatcgccggatttgccgccaaagccaagagcggcaagctg
accatggaagacatgagcggcgggaccttcagcattaccaacggcgggaccttcggcagc
atgatgagcacccccatcatcaacgcgccgcaaagtgcgattctgggcatgcacaacatc
atcgagcgcccgattgcccagaacgggcaggtcgtgatcgcgcccatgatgtacatcgcc
ctgagctatgaccaccgcatcattgacggcaaggaagcggtgcagttcctcgccatggtc
aagaatctgctggaagacccggcccgcatgctcctggaactctga

DBGET integrated database retrieval system