KEGG   Deinococcus deserti: Deide_22540Help
Entry
Deide_22540       CDS       T00880                                 

Definition
(GenBank) putative Phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ddr  Deinococcus deserti
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deide_22540
   01230 Biosynthesis of amino acids
    Deide_22540
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deide_22540
  Energy metabolism
   00680 Methane metabolism
    Deide_22540
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Deide_22540
Enzymes [BR:ddr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Deide_22540
Exosome [BR:ddr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Deide_22540
  Exosomal proteins of melanoma cells
   Deide_22540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2709554..2710162)
Genome map
AA seq 202 aa AA seqDB search
MSHLHLTLLRHGRSRADDEGVHEGRYDSPLTEVGRTQAEALSAYWQAHPPGFDRAYSSTL
LRAQETAQIVTDALQLSLTTTPLLLEWDNGPLAGLSREMALARYPIPEFRHDLDVFTSEG
GESQAAIRARALLALELLWQGGGERLLVVSHGGFLNSLLRELLGSGRVWFAFGDTSFTTV
RLSRTSHTALVTGVNLAPHLAG
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgagccaccttcacctgaccctgctgcgccatggccgcagccgcgccgatgatgaaggt
gttcacgaaggccgttacgattcgcccctgaccgaagtgggccggacgcaggctgaggcg
ctctcggcctactggcaggcacacccaccaggtttcgaccgggcgtatagctcgaccctg
ctccgggcacaggaaacagcgcagatcgtgaccgacgcacttcagctgtccctgacgact
actccgctgctgctggagtgggataacggcccgctggctggtttgtcacgcgaaatggcg
ctggcccgctaccccatcccggagttccggcatgacctggacgtttttacctctgaaggt
ggagagagtcaggccgctattcgggcccgcgccctgctggccctggaactgctctggcag
ggtgggggagagcggctgctggtggtctcacacggaggtttcctgaacagcctgctgcgg
gaactgctgggctccgggcgggtctggtttgcctttggcgacacttcctttaccaccgtc
cgcctgagccgcaccagccacaccgccctggtgactggcgtgaatctggcacctcatctg
gctggatga

DBGET integrated database retrieval system