KEGG   Deinococcus deserti: Deide_23190Help
Entry
Deide_23190       CDS       T00880                                 

Gene name
gmk
Definition
(GenBank) putative guanylate kinase (GMP kinase)
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ddr  Deinococcus deserti
Pathway
ddr00230  Purine metabolism
ddr01100  Metabolic pathways
Module
ddr_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Deide_23190 (gmk)
Enzymes [BR:ddr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Deide_23190 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16
Motif
Other DBs
NCBI-ProteinID: ACO47353
UniProt: C1D084
Position
complement(2776770..2777483)
Genome map
AA seq 237 aa AA seqDB search
MSEAHTTPVEPTAPPRGLLIVMTGASGVGKGTLRELWLRDQDVFYSTSWTTREARPGEVD
GVDYIFVSADAFEQKVQQGGFLEHASFVGNHYGTPVEPIEAALSRGQDVILEIEVEGAMQ
VRDRMGDEAILVFIMPPSLTELRRRLEGRATETPERIEKRLARAREEIMHAHAFRYVIVN
DDLNRAVQELEAVQGAERARQRPESSWTPEDRAAVERAAQVRSDALSEADLLHVVNS
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaggcccacaccactcccgttgaacccaccgctccgccccgcggcctgctgatc
gtgatgaccggcgcgtccggcgtgggcaagggcaccctgcgggagctgtggctgcgtgac
caggacgtcttttacagcacctcctggactacccgggaggcccgcccgggagaagtggac
ggcgtggactacatctttgtcagcgccgacgcctttgaacagaaggttcagcagggtgga
tttctggagcatgcctcgttcgtgggcaaccattacggcaccccggtagaacctatcgag
gcggcgctgagccggggccaggacgtcattctggaaattgaggtcgagggcgccatgcag
gttcgtgaccgtatgggcgacgaggccattctggtgttcatcatgccgccgagcctgacc
gagctgcgccggcgcctggaaggccgcgcgaccgaaacgcccgaacggatcgagaaacgt
ctggcccgtgcccgcgaggaaatcatgcacgcgcacgccttccgctacgtgattgtcaac
gatgacctgaaccgtgcggtgcaggagctcgaggctgtgcagggtgccgaacgggcgcgg
cagcgtccagagagcagctggacgcctgaggaccgcgccgctgtggagcgcgctgcacag
gtccgcagtgacgcactcagcgaggccgatctgctgcacgtggtgaattcctga

DBGET integrated database retrieval system