KEGG   Deinococcus deserti: Deide_2p00220Help
Entry
Deide_2p00220     CDS       T00880                                 

Definition
Glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ddr  Deinococcus deserti
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ddr00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
p2:complement(28642..30141)
Genome map
AA seq 499 aa AA seqDB search
MSQFILALDQGTTSSRAIVFDQEGNIRRVAQKEFRQIFPKPGWVEHDAQEIWSTQIGVAQ
EAISGAGLKASDIAAIGITNQRETVVVWDRHTGQPIHNAIVWQDRRTSTFCDQLRAQGHA
ELFQHKTGLLIDAYFSGTKLKWILDHVEGARERALKGELAFGTVDSWLIYNLTGGALHVT
DATNACRTLLYNIHTGEWDDELLRILDVPREVLPRVCSSSEVYGETAEGLLGARIRIAGI
AGDQQAATFGQACLERGMAKNTYGTGCFMLMNTAHEAVPSKNQLLTTVAWQLGGTRTYAL
EGSVFVAGAVVQWLRDGLGIIRDSSEVEALATSVDSSEGVFLVPAFVGLGAPYWDSYARG
TMVGLTRGTTKAHIARAALESIAYQSAELLEAMGQDSGAPLRELRVDGGASTNNLLMQFQ
ADILGVPVVRPKVTETTALGAAYLAGLAVGYWQGTEEITRQWQVDRIFEPQMAEDERARR
LARWRSAVQRSREWEIAEA
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagttcattctcgcacttgatcagggcaccaccagcagccgcgccatcgttttc
gatcaggagggcaacattcgccgcgttgcccagaaagaattccgccagatctttcccaaa
cccggctgggtcgagcacgacgcccaggaaatctggagcacccagatcggcgtcgcccag
gaggccatctcaggtgcggggctcaaggccagcgacatcgcggccatcggcatcaccaac
cagcgtgagaccgtggtggtctgggaccggcacaccggccagccgattcacaacgcgatc
gtgtggcaggaccgccgcacatccaccttctgtgatcagctccgggcccagggccacgcc
gaactgttccagcacaagaccggcctcctgatcgacgcctacttcagcggcaccaagctc
aagtggattctggatcatgtcgaaggagcccgcgaacgggccttgaagggcgaactggcc
ttcggcacagtcgactcctggctgatctacaacctgaccggcggggcgctgcacgttact
gacgccaccaacgcctgccggaccctgctgtacaacattcataccggcgagtgggacgac
gagctgctgcgcattttggacgtgccgcgcgaggtcctgccacgggtatgcagcagcagt
gaggtgtacggcgaaaccgccgaggggctgctcggagcccggatcaggatcgccgggatc
gccggggaccagcaggctgcgaccttcgggcaggcctgtctggagcggggaatggccaag
aacacctatggcacgggctgcttcatgctgatgaacacggcgcatgaagcggttcccagc
aagaatcagctgctgaccacggtggcgtggcagcttggcggcacgcgcacctacgccctg
gagggcagtgtgtttgtggccggcgcggtcgtgcagtggctgcgggacgggttgggaatt
atccgtgacagcagtgaggtcgaagccctggccaccagtgtcgacagcagcgagggtgtc
ttcctggtgcctgcttttgtggggctgggcgcaccgtactgggacagctacgcccgcggc
accatggtgggcctgacacggggtaccaccaaagcacatatcgcacgcgccgctctggaa
agcatcgcctaccagtcggcagaactgctcgaagccatgggacaggacagcggcgccccg
ctgcgggagctgcgcgtggacggtggcgcaagcaccaacaaccttctgatgcagttccag
gccgacatcctgggcgttccagtggtgaggcccaaagtgacggagacgaccgcactgggc
gcagcctacttggctggactggccgtggggtactggcagggcacggaggagattacccgt
cagtggcaggtggaccgcattttcgagccgcagatggccgaagacgagcgggcccgccgc
ctggcacgctggcgaagtgccgtgcagcgcagccgcgagtgggaaatcgccgaagcctga

DBGET integrated database retrieval system