KEGG   Deinococcus deserti: Deide_2p01680Help
Entry
Deide_2p01680     CDS       T00880                                 

Gene name
chlD
Definition
magnesium chelatase, chlD subunit
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
ddr  Deinococcus deserti
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Deide_2p01680 (chlD)
Enzymes [BR:ddr01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Deide_2p01680 (chlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
p2:237335..239104
Genome map
AA seq 589 aa AA seqDB search
MSPQIQYPLSAVAHQPELLLALSLLAVAPELGGVLIRGDRGAAKSTAARGLASLLPARQD
GEAAPFVNLPLGASEDRVVGSLDLDAALRGEARLRGGLIAAAHGGVLYIDEVNLLPDHLV
DVLLDAAAMGVHRVQRDGLSVEQPARFALVGSMNPEEGALRPQFLDRFGLCVDVQAPREA
AQRADIMRRRMAFETDPDGFQATWHPQETALRERLHAARQRLPGVTLPDALLTAIATLSA
DSGVRSLRADLVLHRAARALAALEGRAQVHEDDLHQVAPLVLVHRRDPRLAPLPPPPSRP
PPPEPPSTHSEPPEPESDESSDQHSAPDTQESSNLQEAPETPEDVLPPTPGSAPVRLAAL
PAPGRHPGGAAQGRVVRAAPDSQTSRLALPDTLRAALLRSGGKPFELSRADFHTPVHEKR
GGRRVLFVADTSGSMGAQGRMGAVKGAMLAVLEQQARRDRVALITFRATGAVRALEWTAD
ATLAEAAITAAPTGGRTPLAHALVLAREVLATEPGAELVLFTDGRANVALSPSGDAWADA
LEAARALGGVPALVVDTEAGHVRLGRAGALAEVLGARVQPLWPTPVGAP
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgagcccacagattcagtacccgctgagtgcggtggcgcatcagcccgaactgctgctg
gcgctctcgctgctggcggtggctccggaactcggtggcgtcctgatccggggcgaccgc
ggcgcagcgaaaagcactgccgcgcgcggcctggcgtcgttgctgcccgcacgtcaggac
ggcgaggcggcgccgtttgtcaacctgcccctgggcgccagtgaggaccgggtggtgggc
agcctggacctggacgccgcactgcgcggtgaggcccggctcaggggcggcctgatcgcc
gcagcccacggcggcgtgctgtatatcgatgaggtcaacctgcttcccgaccatctggtc
gacgtcctgctggacgccgcggccatgggcgttcaccgggtgcagcgcgacggcctgagc
gtcgagcagcccgcccgctttgccctggtgggcagcatgaatcccgaagagggagcgctg
cggcctcagtttctggaccgcttcggcctgtgcgtggatgtccaggccccacgggaagcg
gcgcagcgcgcggacatcatgcgcaggcgcatggctttcgagacggacccggacggtttt
caggccacctggcacccgcaggagaccgccctgcgtgagcggctgcacgcagcccggcag
cggctgccgggagtcaccctgccggacgccctgctcacggcgatcgccaccctcagtgcc
gactctggtgtacggagcctgcgtgccgatctggttttgcaccgcgctgcgagggccctg
gccgcgctggagggacgcgctcaggtccacgaagatgatcttcatcaggttgctccgctg
gttctggttcaccgccgagacccccgcctggcaccgctgccgccgcccccgtcccggcca
ccaccgcctgaacctccctccacccacagcgagccgccggagcccgagtcggacgagagc
agcgaccaacactccgccccagatacccaggaatcctcaaacttgcaggaagctccagaa
acaccggaagacgtcctgccgcccacacccggaagtgctccggtacgtctggctgccctt
ccagccccaggccggcatccgggtggtgcggcccaggggcgggtggtgagagctgcgcct
gattcgcagaccagccgcctggccctgcctgacacccttcgcgctgccctgctacgcagc
ggcggaaagccgtttgagctgtcccgcgccgatttccacacaccggttcacgagaagcgc
ggaggccggcgggtgctgtttgtcgctgacaccagcggcagcatgggcgcgcagggccgc
atgggcgcggtcaaaggcgccatgctggcggtgctggagcagcaggcgcggcgtgaccgg
gtggccctgatcaccttccgtgcgacgggagcggtacgggcgcttgaatggactgccgac
gccacgctggccgaggcggcaatcacggcagccccgaccggaggccgcactccgctggcc
cacgcgctggtcctggcgcgcgaggttctggccaccgaacccggcgccgaactggtgctg
ttcaccgatggccgggccaacgtggcgctctcaccgtcgggtgacgcctgggccgacgcg
ctggaagccgcccgcgccctgggtggtgttccggcgctggtggtggacaccgaagccggg
catgtgcggctgggccgcgccggggccctggctgaagtgctgggcgcgcgcgtgcagcca
ctctggcccacaccagtgggggccccgtga

DBGET integrated database retrieval system